KEGG   Drosophila mojavensis: Dmoj_GI11709Help
Entry
Dmoj_GI11709      CDS       T01062                                 

Definition
GI11709 gene product from transcript GI11709-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 710 aa AA seqDB search
MHVCLCVCECVIKVAKIRRKQRKCDKTTVPQPSAKRTKTKENSVDSTTSILSSGSGSGSS
SGAGSRASSGNNNTSNNNSKRAYAFLGRGAADVVPEVRLLPTTATAPTTLTRAAAAAAAA
AAAAATTTATNTEAAAGRCPAEETVVVSGGRVGGGVEGAQLTKGPLNAANLSLPVCLRTV
QKLAAELDGKADVNVNVSDSSDVDGDSDANVNDMSETGCRHYQSYVKEHSYDTFRVIDAY
FAACVNKDAREKKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRAKKHNIALEL
SHGTLYCYACRDFIYDARSREYAIINRKLEAKDLQKSLGWIPWIPTPKETNLLLANARRR
LVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGKSSHKCLVCEVSR
LFQEFYSGSRTPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKSEHE
SKSNSSSATGGNSSSSANATATHSYGQCNCIIDQIFTGMLQSDVVCQACKGVSTTFDPFW
DISLDLGETTSHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLP
SVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKNNAYGDFRFSLYAVVNHVGTI
DTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEYE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgtgcttgtgcgtgtgcgagtgtgtcataaaagtggccaaaattcgacgaaaa
cagcgcaagtgtgataaaaccacagtgccacagccgtctgcaaaacgaacgaaaacaaaa
gagaacagtgttgatagtacgacaagcattttaagcagtggcagcggcagcggtagcagc
agcggcgccggcagtcgagccagcagtggcaataacaacaccagcaacaacaacagcaag
cgcgcatacgcgtttttgggccggggagcggccgacgttgtacctgaagttcgtttactc
ccaacaacagcaacagcgccaacaacacttactcgagcagcagcggcggcggcagcggca
gcggccgcagcagcgacaacaacagcaacaaacacagaggcggctgccggccggtgtccg
gctgaggaaactgttgttgttagtggtgggcgggtcggtgggggcgtggaaggcgcacag
ctaacaaagggtccactgaatgcggcgaatttgtcgctgcccgtctgcttgcgcaccgtg
caaaagcttgccgctgagctcgacggtaaagccgacgtcaacgtcaacgtcagcgacagc
agcgacgtcgacggcgacagcgacgctaacgttaacgacatgtcggaaacgggctgccgg
cactatcagagctacgtaaaggagcacagctacgatacctttcgtgttatcgatgcctac
ttcgctgcctgcgtcaacaaggatgcgcgtgagaaaaaggccatacactgcaattgcttc
gagtgcggcagctatggcatccagctgtacgcctgcctgcattgcatctactttggctgt
cgcggcgctcacatcaccagccatctgagggccaagaaacacaatatcgcattggagctg
tcgcacggcacgctttactgttatgcgtgtcgtgacttcatatacgatgcacgcagccgt
gagtacgcgataattaatcgcaagctagaagcaaaggatctgcaaaagagcctcggctgg
ataccatggataccgacgcccaaggagacgaatctgctgctagccaatgcacggcggcgt
ctggtgcgacccaatcagacaattgggctgcgagggttgctcaatctgggtgctacctgc
ttcatgaactgcattgtccaggctctggtacacacgccgctgctgagcgactatttcatg
tcggatcgccacgactgtggcaagtcctcacacaagtgtttggtatgcgaggtgtcgcgt
ctcttccaggagttctattcgggctcacgtactccattgtcgctgcatcgtttgctgcat
ttaatttggaatcatgcgaaacatctggccggctatgagcagcaggatgcgcatgagttc
tttatcgccacgctggatgtgctgcatcggcattgtgtgaaggccaagtcggagcacgag
agcaagagcaacagttcgagcgccacgggtggcaattccagctccagtgccaatgcaact
gcgacgcattcctatggccagtgcaattgcatcatcgatcaaatctttacgggcatgctg
cagagcgacgtcgtgtgccaggcatgcaaaggcgtttccaccacattcgatcccttctgg
gacatctcactggatctcggcgagacgacatcgcatggcggcgtcacaccgaaaacgctg
atcgattgcctggagcgctatacacgggccgagcatctcggctcggcggccaaaatcaaa
tgctccacctgcaaatcgtatcaggagtccaccaaacagttcagcctgcgcactctgccc
agcgtcgtgtcgttccacctgaagcgcttcgagcattcggcactgatcgatcgcaaaatc
tcatcgtttattcagtttcccgttgagttcgatatgacgccctttatgtccgagaagaac
aatgcctatggggactttcggttctccctgtatgccgttgtcaatcacgtgggcaccatc
gataccggacactatacggcctacgtgcgacatcagaaggacacgtgggtcaagtgcgat
gatcatgtgataacaatggcatcgctcaagcaggtgctcgacagcgagggttatttatta
ttctatcataagaatgtcttggaatacgagtga

DBGET integrated database retrieval system