KEGG   Drosophila mojavensis: Dmoj_GI11709Help
Entry
Dmoj_GI11709      CDS       T01062                                 

Definition
(RefSeq) GI11709 gene product from transcript GI11709-RB
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI11709
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI11709
Transcription machinery [BR:dmo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dmoj_GI11709
Ubiquitin system [BR:dmo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmoj_GI11709
Chromosome [BR:dmo03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     Dmoj_GI11709
    SLIK complex
     Dmoj_GI11709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 725 aa AA seqDB search
KKQKTDQKATKRQSSYFTQFVSRVFSIKVAKIRRKQRKCDKTTVPQPSAKRTKTKENSVD
STTSILSSGSGSGSSSGAGSRASSGNNNTSNNNSKRAYAFLGRGAADVVPEVRLLPTTAT
APTTLTRAAAAAAAAAAAAATTTATNTEAAAGRCPAEETVVVSGGRVGGGVEGAQLTKGP
LNAANLSLPVCLRTVQKLAAELDGKADVNVNVSDSSDVDGDSDANVNDMSETGCRHYQSY
VKEHSYDTFRVIDAYFAACVNKDAREKKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHI
TSHLRAKKHNIALELSHGTLYCYACRDFIYDARSREYAIINRKLEAKDLQKSLGWIPWIP
TPKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHD
CGKSSHKCLVCEVSRLFQEFYSGSRTPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATL
DVLHRHCVKAKSEHESKSNSSSATGGNSSSSANATATHSYGQCNCIIDQIFTGMLQSDVV
CQACKGVSTTFDPFWDISLDLGETTSHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCK
SYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKNNAYGD
FRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKN
VLEYE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
aaaaagcagaaaactgatcaaaaggccacaaaacgacaaagttcctattttacacaattc
gtgtcccgtgtgttcagcataaaagtggccaaaattcgacgaaaacagcgcaagtgtgat
aaaaccacagtgccacagccgtctgcaaaacgaacgaaaacaaaagagaacagtgttgat
agtacgacaagcattttaagcagtggcagcggcagcggtagcagcagcggcgccggcagt
cgagccagcagtggcaataacaacaccagcaacaacaacagcaagcgcgcatacgcgttt
ttgggccggggagcggccgacgttgtacctgaagttcgtttactcccaacaacagcaaca
gcgccaacaacacttactcgagcagcagcggcggcggcagcggcagcggccgcagcagcg
acaacaacagcaacaaacacagaggcggctgccggccggtgtccggctgaggaaactgtt
gttgttagtggtgggcgggtcggtgggggcgtggaaggcgcacagctaacaaagggtcca
ctgaatgcggcgaatttgtcgctgcccgtctgcttgcgcaccgtgcaaaagcttgccgct
gagctcgacggtaaagccgacgtcaacgtcaacgtcagcgacagcagcgacgtcgacggc
gacagcgacgctaacgttaacgacatgtcggaaacgggctgccggcactatcagagctac
gtaaaggagcacagctacgatacctttcgtgttatcgatgcctacttcgctgcctgcgtc
aacaaggatgcgcgtgagaaaaaggccatacactgcaattgcttcgagtgcggcagctat
ggcatccagctgtacgcctgcctgcattgcatctactttggctgtcgcggcgctcacatc
accagccatctgagggccaagaaacacaatatcgcattggagctgtcgcacggcacgctt
tactgttatgcgtgtcgtgacttcatatacgatgcacgcagccgtgagtacgcgataatt
aatcgcaagctagaagcaaaggatctgcaaaagagcctcggctggataccatggataccg
acgcccaaggagacgaatctgctgctagccaatgcacggcggcgtctggtgcgacccaat
cagacaattgggctgcgagggttgctcaatctgggtgctacctgcttcatgaactgcatt
gtccaggctctggtacacacgccgctgctgagcgactatttcatgtcggatcgccacgac
tgtggcaagtcctcacacaagtgtttggtatgcgaggtgtcgcgtctcttccaggagttc
tattcgggctcacgtactccattgtcgctgcatcgtttgctgcatttaatttggaatcat
gcgaaacatctggccggctatgagcagcaggatgcgcatgagttctttatcgccacgctg
gatgtgctgcatcggcattgtgtgaaggccaagtcggagcacgagagcaagagcaacagt
tcgagcgccacgggtggcaattccagctccagtgccaatgcaactgcgacgcattcctat
ggccagtgcaattgcatcatcgatcaaatctttacgggcatgctgcagagcgacgtcgtg
tgccaggcatgcaaaggcgtttccaccacattcgatcccttctgggacatctcactggat
ctcggcgagacgacatcgcatggcggcgtcacaccgaaaacgctgatcgattgcctggag
cgctatacacgggccgagcatctcggctcggcggccaaaatcaaatgctccacctgcaaa
tcgtatcaggagtccaccaaacagttcagcctgcgcactctgcccagcgtcgtgtcgttc
cacctgaagcgcttcgagcattcggcactgatcgatcgcaaaatctcatcgtttattcag
tttcccgttgagttcgatatgacgccctttatgtccgagaagaacaatgcctatggggac
tttcggttctccctgtatgccgttgtcaatcacgtgggcaccatcgataccggacactat
acggcctacgtgcgacatcagaaggacacgtgggtcaagtgcgatgatcatgtgataaca
atggcatcgctcaagcaggtgctcgacagcgagggttatttattattctatcataagaat
gtcttggaatacgagtga

DBGET integrated database retrieval system