KEGG   Drosophila mojavensis: Dmoj_GI11853Help
Entry
Dmoj_GI11853      CDS       T01062                                 

Definition
GI11853 gene product from transcript GI11853-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dmo  Drosophila mojavensis
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI11853
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dmoj_GI11853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 316 aa AA seqDB search
MARLIESNFVPIAMGVAAIVAGALIVHYFINKKSTKPRREPNRTARLRTLVDPNDKYQLP
LIEKEVLSADTRRFRFGLPSKQHILGLPVGQHIHLIATIDNELVIRPYTPISSDDDVGYV
DLIVKVYFKDTHPKFPAGGKMTQYLERMELGDKIAFRGPSGRLQYLGNGTFSIKKLRKDP
PKQVTAKCVNMIAGGSGITPMLQLVREVLKHSDKDKTQLALLFANQSEKDILLRDELDTL
AKQHPDQFKVWYTVDKASEGWTYSVGFVNDEMIAAHLLPANDDTIVLLCGPPPMINFACN
PALDKLGYHPDLRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtctaattgagagcaattttgttccgattgctatgggcgttgcagccatcgtt
gccggggcattgatagtccactattttatcaataagaagtcgacgaagccccgtcgcgaa
cccaaccgaactgcacgattacgcactctggtcgatcccaatgataagtaccagctgcca
ctgatagagaaggaggtgctcagcgctgatacgagacgttttcgcttcggtctgccctcc
aagcagcatatactgggtctgcctgtgggccagcatatccatctgatagcgacaattgac
aatgagctggtcatacggccgtatacacccatctcctccgatgacgatgtcggctacgtg
gacctgattgtgaaggtgtacttcaaggatacgcatcctaaattcccagcgggtggcaaa
atgacacagtacttggagcgaatggaattgggcgataagatcgcgttccgtggtccctcg
ggtcgcttgcaatatctgggcaacggcaccttctccattaagaaactccgcaaagatcca
cccaagcaagtgacggccaagtgcgtcaacatgattgccggcggcagtggcattacgccc
atgttgcagctcgtgcgcgaagtgctcaagcacagcgacaaggataagacacagctggcg
ctgctctttgccaatcagagtgaaaaggatatcttactgcgtgacgaactagataccttg
gccaagcagcatcccgatcagtttaaggtctggtacaccgtggacaaagcaagcgaaggc
tggacttatagtgttggcttcgtcaatgatgagatgatcgccgctcatctgctgcccgcc
aatgacgacacgatcgtgctgctctgcggcccgccgcccatgattaactttgcctgcaat
ccagcactagacaagctcggctaccatccggacctacgatttgcgtattag

DBGET integrated database retrieval system