KEGG   Drosophila mojavensis: Dmoj_GI12045Help
Entry
Dmoj_GI12045      CDS       T01062                                 

Definition
GI12045 gene product from transcript GI12045-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dmo  Drosophila mojavensis
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:dmo00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 391 aa AA seqDB search
MTANSLLGRSLLNEGRSNKRSLVSLIVGLVVGFCLAELFVYSSTPERGEFAPYDGHRHGD
VNDAHHSHDMLELSGPEQDIGTHEHSNENTSIAEKLHSEVRILCWIMTNPSNHKKKARHV
KRTWGKRCNKLIFMSSAKDEELDSVALPIGEGRNNLWGKTKEAYKYIYEHHINDADWFLK
ADDDTYTIVENMRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEA
LPNPKLCKQDNTGAEDVEIGKCLENVKVLAGDSRDANGRGRFFPFVPEHHLIPSHTDKKF
WYWQYIYYKTDEGLDCCSDYAISFHYVSPNQMYVLDYLIYHLRPYGIVNRPDVLPNKLAV
GELMPAPKEPKVIELPKPSEESMTEPEKEAQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatagcctattgggacgctccttactcaatgaaggacgctccaacaaacgt
tcgttagtctcactgattgtcggcctggtcgttggcttctgcctggccgagctgtttgtc
tactcatccacgccggaacgtggcgagtttgcgccctacgacggccatcggcacggcgat
gtcaacgacgcccatcacagtcacgacatgctggagctgtccggccccgaacaggatatc
ggcacgcacgagcactcaaatgagaacacaagtattgccgagaaattgcatagcgaagtg
cgcattctctgctggattatgacaaatccctccaatcacaagaagaaggcgcgccacgtg
aaacgcacctggggcaagcgatgtaataagctgatcttcatgagctcagccaaggatgag
gaactggattctgtggccctgcccataggcgaggggcgcaacaatctctggggcaaaacg
aaagaggcctacaaatatatctatgagcaccatatcaacgatgcggactggtttcttaag
gctgacgacgatacctacacgatcgtcgagaatatgcgctatatgctatatccctataac
ccagagacgcccgtctacttcggctgcaagtttaagccatatgtcaagcagggctatatg
tctggtggagctggatatgtgctcagtcgcgaggcagtgcgtcgctttgtggtggaagcg
ctgcccaatcccaagctatgcaaacaggataacaccggtgctgaggatgttgagataggc
aaatgcttagagaatgtcaaagtactggcaggcgattctcgtgatgccaatggacgtgga
cgcttctttccctttgtgcccgagcaccatttgataccatcgcatacggacaagaagttc
tggtactggcaatacatttactacaaaacagatgagggtctggattgctgttcggactac
gccatatcatttcactatgtctcgcccaatcaaatgtatgtcctggactatttgatatac
catttgcgaccatatggtatagttaataggccagatgtattgcccaataagctggcggtg
ggcgaactgatgccagcgcccaaagagccgaaggtgatcgaattgcccaagccgtcggag
gaatcgatgaccgaaccggaaaaagaagcgcaatga

DBGET integrated database retrieval system