KEGG   Drosophila mojavensis: Dmoj_GI12135Help
Entry
Dmoj_GI12135      CDS       T01062                                 

Definition
GI12135 gene product from transcript GI12135-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dmo  Drosophila mojavensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI12135
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dmoj_GI12135
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI12135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 526 aa AA seqDB search
MRTIQFLASLWLLLHLAACVLGGAVPVQPVDDDDEEAMHPHLQANPRTSERSSNAENTQD
YWLSASKEHILEKLNFVRNTKRAKNIILFLGDGMGLATLAAARSYLGGEEKKLYFEKFPF
TGLSKTYCVDKIVPDSASTSTSYLCGVKANYGTIGVSANVKRGDCQAMADKSNHVFSVGK
WAMDAGKAAGLVTTTRVTHASPSGVYAHTADREWENNAVLEEACGDLAKDLDDIAVQLIH
GEVGSKLKVMLGGGRRNFMDLEFYKNGRRTDGRNLVEEFEAMSDRNVYVKNRKKLLKVDP
ATTDRLLGLFAKSHLHYHEEQLADPENTEPTLEEMTQKAIEVLQTEENGYFLFVEGGKID
ISHHDTMARIALDETAELSKAVKLARKMTSEEDTLIVVTSDHSHTFSLGGYQPRGSDIFG
KAESSGTDDKPYLALSYANGKSFETYYDVMAHQRVDPTSLLADNADVAQLFPATAPLESE
THGGEDVGVFASGPWAHIFTGVYEQNAIPHMLAFAACVGDGQTACD
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaattcagttcctcgcgagtctttggctgttgctgcacttggcggcctgtgtc
ttgggtggcgctgtgcccgtccagccagtggacgacgatgatgaggaggcaatgcatccc
catctgcaggcaaatccacggacgagtgagcgtagcagcaacgccgagaacacacaggac
tattggctctcagcgagcaaggagcacattctggagaagctcaacttcgtgcggaacaca
aagcgtgcaaagaacatcattctcttcctgggcgacggcatgggtctggcaactctggcg
gctgccaggagctacttgggtggcgaggagaagaagctctacttcgagaagtttcccttc
actggcctctccaaaacctactgtgtggacaaaattgtgcccgactcggcatcgacctcc
acatcctatctgtgcggcgtgaaggccaactacggcacgattggagtcagcgcgaacgtg
aaacgtggtgactgccaggccatggccgacaaatccaatcatgttttctccgtgggcaaa
tgggcaatggacgcgggcaaagccgccggcctggtgaccacaacccgtgtgacccacgcc
tcgccctcgggcgtctatgcgcacactgccgatcgggagtgggagaacaatgccgtgctg
gaggaggcgtgtggcgacctggctaaggatctcgacgacattgcagtgcagctaattcac
ggcgaggtcggcagcaaactgaaggtgatgcttggcggcggcagacgtaacttcatggat
ctcgagttctacaagaatggccgacgcacggacggacgcaatctggtcgaagaattcgaa
gccatgtctgaccgcaacgtctatgtgaagaatcgcaagaagctgctcaaggtggatccc
gcgacaacggaccgcctgttgggtctgttcgccaagagccacctgcactaccatgaggag
cagctggccgatccagagaacacggagcccacgctggaggagatgacccagaaggccatt
gaggtgctccagaccgaggagaacggctacttcctgttcgtggagggtggcaaaatcgat
atcagccatcacgatacgatggcccgcatcgccctggacgagaccgccgaactgtcgaag
gccgtgaagctggcgcgcaaaatgaccagcgaggaggacactctgatcgtggtcacctcc
gatcactcgcacaccttcagcctgggtggctaccagccgcgcggcagcgacatcttcggc
aaggccgagtcctccggcaccgacgacaagccctatctggccctgagctatgccaatggc
aagagcttcgagacctactacgatgtgatggcgcaccagcgcgtcgatcccacgtccttg
ctggcggacaacgctgatgtggcccagctgttcccagccaccgcaccactggagtccgag
acgcacggcggcgaggatgttggcgtctttgcctcaggtccctgggcccacatcttcacc
ggcgtctacgagcagaacgccattccacatatgctggcctttgccgcatgcgtgggcgat
ggccagacagcctgtgattga

DBGET integrated database retrieval system