KEGG   Drosophila mojavensis: Dmoj_GI12139Help
Entry
Dmoj_GI12139      CDS       T01062                                 

Definition
GI12139 gene product from transcript GI12139-RA
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1564 aa AA seqDB search
MAEKDNKDSTQCAVFDQTPGSQQKKINVVVRSHFTVKHVITLIGTQFAYGKFELLLQPHG
EKDLVYLNTLDTQLLYDVPGFEPKLKNNLVLLPEGTWDGNVAKRYDLTIKKSASTVSKQP
EITENTTTTNTVTTTTTAAAAIPTTISTTTVKTGEKKKRTTTTTGEKKKKSPSKTKASVS
PTSESAVELSTEATVAAATAATPTTPSKISTKVKTKANEKNGIAEKSTDQVDEGVKLQSA
TVNSAANVAKDAPTKVEVADPLKEQLSQNSIIDDVAPELFNISPVSDAEQLSDDDLALGA
SASPTIMGPGFEFGNTAEVDLLGSTDADTDPLEPNFERDVPYYSSLASRKFGGDEVPAWQ
RINTTASDFVASANTETETHRNGSGPRAYVGLVNQAMTCYLNSLLQALYMTPEFRNALYR
WEFDNDNEAKNIPYQLQKLFLNLQTSSKSSVETTDLTRSFGWDSTEAWQQHDIQELCRVM
FDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAY
GSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTM
HRIKLNDRVTFPQKLNLNSFVNRNGQGEQYQMNGASNVDDCSTADSGSAMDEDNLSSGVV
TTASSSQHENDINDEDEGIDMSSSTGKSANTEARLKQELLSGPYLYDLFAIMIHSGSASG
GHYYAYIKDFDTDEWFCFNDQNVSTITQQDIQRSFGGPNGSYYSSAYTSSTNAYMLMYRQ
VDSKRNEHAAKCNDFPEHIKSLLPKLHAEEDTRVSRLGRHITVTDLALPNLYKPRVYFYN
PTLKKMKMTRVYLSQNFDVNKVLTSAHDMLNVEQFAPISRCRLVAYDSSMDTIIQSLENC
TDPALTELRSHNYNLDFLLEYRAEDQQFENYPSDGTTWYVFKVDLSNMAMDGPFLVYSAA
LECNDVLRRSIAIRLHIDEQKIVVATVRCKAFVAYDPNPTLETQQQLEQLANSQFKYITY
FYLNVPNTDASSLEMLGVPSSEPIATPIEATNNGSAGTDVVDASMMNGISGTNGTATPEA
ANAGNNDCDWRRYKRDQPDSLALATPGHESNSEDSSLSDGDRTLVENSLQHRGGGDSQVS
STSHSPQLSSPEDEAASHDTMMRVHAYCNGNGSYGSDAGDASSLPASSTNHFFHAIKIDC
VDTAASSSTSGHQSDDEAQLRKPTHAYKLLVGTHMRMSAFERHIEQLIHVPSKYFKLQRK
HDNTLSNDQANSLVFLNEGETLTVEIGKTLQPFEYKAKIYFLRLSDLDNETAKLPCVCEW
VYNTTTTVEQAKQELVAKLHRIDAKYTSLTMDNCRIWLKGGRCPIKILADDETLYNDMRT
GSLEFIVQECEDGVVAQPKDDALTIFVRRWYPEKWEFGKFQEITIDKDSEIRSCLSKICD
IDIDRLSYTKLNSYFPCTSISAVSVNEAVNWMSVAVGLDMYPLNTTQSGNMYLYKDKNAA
VRELSAEERRSLTNKEKARLDRLGCISTPRYSHRRERALKIYLDSPEKPSNVTASAPVDA
HAEN
NT seq 4695 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaggacaacaaggatagcacacagtgcgccgtctttgaccagacgcctggc
tcccagcagaagaaaatcaatgtcgttgtgcgttcccatttcacggtgaagcacgtcatc
acactgattggcacgcagtttgcgtatggaaaatttgagctgttgctacagccgcacggc
gagaaggatctggtttatctgaatactctggatacgcagctgttgtacgatgtgcctggc
tttgagccgaagctgaagaacaacctggtgctgctgccagagggcacctgggatggcaat
gtggccaaacgttatgatttgaccattaagaaatctgcttcaacagttagcaagcagcca
gagatcacagagaacacgacaacgacaaacacggtaacaacaacaacaacagcagcagct
gcaataccaacaacaatatcgacaacgacggttaaaaccggtgagaagaagaagcgcacg
acaacaacaaccggggagaagaagaaaaagtcgccaagcaaaaccaaggcaagcgtcagt
cccacatctgaatcagcagttgagttatcaacagaagccacagttgccgctgcgactgct
gccacacccacaacgcctagcaagatcagtacaaaagtgaaaaccaaagccaacgaaaag
aatggcattgctgagaagagtacagatcaggtggacgaaggtgtgaagctacaaagtgca
acggtcaactcagctgccaacgtagctaaggacgcgccaaccaaagttgaagtagccgac
ccgctgaaggagcagttgtcgcaaaacagtatcattgacgatgtagctcccgagctcttt
aatataagccccgtctcggatgctgagcaactgtcggacgatgatttagcactgggcgcc
tcggccagtcccacgatcatgggtccagggttcgaattcggcaacacagcagaggtcgat
ctgttaggcagcactgatgccgacaccgatccactagagcccaactttgaacgagatgtg
ccctattatagctcactggcatcgcgcaagttcggtggcgacgaggtgcccgcctggcag
cgcatcaataccaccgcctccgactttgtggcctcggccaatacagaaacagagacgcat
cgcaatggtagcgggcctcgtgcatatgtcggattggtcaatcaggcaatgacctgctac
ctaaacagcttgctccaggcgctctatatgacacccgagtttcgcaatgccctgtatcgc
tgggagtttgacaatgacaacgaggccaagaatataccctaccagctgcaaaagctgttc
ctcaatttgcagacatcgtcgaaatcatcggtggagacgacagacttgacgcgcagcttt
ggctgggactcgacggaggcctggcagcagcacgacatccaggaactgtgtcgcgtcatg
ttcgatgcactggagcataagtttaagaacaccaagcaggcaaatctcatctctaatctg
tacgagggcaaaatgaacgattatgtcaagtgcttggagtgcaatacggaaaagacgcgc
gaagatacctttcttgatataccactgccagtgcgtccgtttggcagcagttccgcctac
ggcagcatcgaggaggcgctgcgcgcatttgtgcagcccgaaactctcgatggcaacaat
cagtatctgtgcgagaagtgcaaaaagaaatgcgacgcccacaagggactgcacttcaag
tccttcccctacatactgacgctgcatctgaagcgcttcgattttgactatcagacaatg
catcgcatcaaactgaacgatagagtaacctttccgcaaaagctgaatttgaacagcttt
gtgaatcgcaatggacagggcgaacagtatcagatgaatggtgccagcaatgtggacgat
tgcagcacggcggacagtggctccgccatggacgaggacaacttgagcagcggcgtagtg
accacggccagttccagtcagcacgagaacgacatcaacgacgaggacgagggcatcgac
atgagcagcagcactggcaaaagcgccaacacggaggcacgactgaaacaggagctgctg
tcgggtccctatctgtacgatctgtttgccatcatgatacactcgggcagtgcttcaggc
ggccattactatgcatatatcaaagactttgacactgacgagtggttctgtttcaacgat
cagaatgtatccacgatcacacaacaggacattcagcgctcctttggcggccccaatggc
agctattactccagcgcttatacgtccagcacgaatgcttatatgctaatgtatcgccag
gttgatagcaagcggaatgagcatgcggccaagtgcaatgactttcccgaacacatcaaa
tcacttctgcctaaactgcatgccgaggaggatacgcgcgtctcccgcctgggcagacac
atcacggtgacagatctggctctgccaaatctgtacaagccccgcgtctacttctacaat
ccgacgctgaagaagatgaagatgacccgtgtttatctgtcgcagaatttcgatgtgaat
aaggttctgacgtcggcccacgacatgctcaatgtggagcagttcgctccgatctcacgc
tgtcgcttggttgcatacgattcgtccatggacacgatcatacagtcacttgagaactgc
acagatccggctctaaccgaactgcgttcccacaactacaatttggactttttgctggag
tatagggccgaggatcagcagtttgagaactatcccagcgatggcactacgtggtatgtt
tttaaggtagatctctcgaacatggcgatggacggtcccttcctggtttattcagcagcg
ctggagtgcaacgacgtgctgcgtcgctcaattgcaattcgtttgcacattgacgagcag
aagatcgtggtggccaccgtgcgctgcaaggcctttgtggcgtacgatcccaacccgaca
ctggaaacacaacaacagctagagcaactggccaactcacaattcaaatacatcacatac
ttttacttaaatgtgcctaacaccgatgccagcagcctcgagatgctgggcgtgcccagc
agcgagcccattgcaacgccgatcgaggccaccaacaatggcagcgccggcaccgatgta
gtggatgcctccatgatgaacggcatcagcggcacaaacggcacggcaacccccgaagct
gccaacgccggcaacaacgactgtgattggcgtcgctataagcgcgatcagcctgattcg
ctggcgctggcgacgcccggccacgagtccaactcggaggacagcagcctgagtgacggt
gatcgcacactggtcgagaatagcttgcagcatcgcggtggcggcgatagccaagtcagt
tccaccagccattcaccgcagctgtccagtcccgaggacgaggccgcctcccacgacacc
atgatgcgcgtgcatgcctattgcaatggcaacggcagctatggcagcgacgcgggcgat
gccagctccctgccagctagctcaaccaaccactttttccatgccatcaagatcgactgc
gtggatacggccgccagcagcagcaccagcggccatcagtccgatgacgaggcgcaactg
cgtaagccgacgcacgcttataaacttctcgtgggcacgcacatgcgcatgagcgccttc
gagcggcacattgagcaattgatacacgtgcccagcaagtactttaagttacaacgcaag
catgataataccctatccaatgatcaggccaactcgctagtcttcctcaatgagggcgag
acactgactgttgagatcggcaagacgctgcaaccgttcgagtacaaggccaagatatat
ttcttgcgtctgtctgacctggacaatgagaccgccaagctgccgtgcgtctgtgagtgg
gtgtacaataccacaaccactgtagagcaggccaaacaggagctggtggccaagctgcat
cgcatcgatgccaaatacacctccctcactatggacaactgccgcatctggctgaaaggc
ggccgctgtcccatcaaaatactcgcggacgatgaaacactgtacaacgatatgcgcact
ggttccctagagttcattgtgcaagagtgtgaggatggtgtggtggcacagcccaaggat
gatgcgttaactatattcgtgcgtcgctggtatccagaaaaatgggagtttggcaaattt
caggaaatcacaatcgacaaggacagcgaaattagaagttgtttatcaaaaatatgcgat
attgatattgaccgattgagttatacaaagcttaacagctattttccctgcacaagcata
tcggcagttagcgtgaatgaggccgtgaactggatgtctgtggccgtcggcctggacatg
tatcccctgaacaccacgcaaagcggcaacatgtatttgtataaagataagaatgcggcg
gtgcgagagctgtcagcagaagagcgccgctcgttgaccaataaggagaaggcgcgcctg
gatcgactcggctgcatttcaacgccccgctactctcatcgacgcgaacgagcgctgaag
atttatttagattcgccggagaagcctagcaatgtgaccgcctcggcgccggtagatgca
catgccgaaaactaa

DBGET integrated database retrieval system