KEGG   Drosophila mojavensis: Dmoj_GI12154Help
Entry
Dmoj_GI12154      CDS       T01062                                 

Definition
GI12154 gene product from transcript GI12154-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dmo00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 571 aa AA seqDB search
MRQRKGCIKQKTRRQKQQKFLDIDQNCCKRPRCNYEHIWQHFRRNATLEEIRQAAARICR
DYLTGRWKVVTPEQLVVKRISGGLSNFLYYVSLPDLDDFDEQQLLEVEQQQQQTGNVNVN
IGKHVIAASAFAKNSENNNNNNNNNNNNNNIKDVAPEVTKNPSAITHADDDDDDAALSAK
QANKRRRFDSDSGDSLLRRLHSPKQEPREVLLRIYGQTHGDHALETMITESVVFALLSER
NFGPKLHGIFPGGRIEQYIPARTLTTTELGDARISMKIAEKMGEIHSLNIPMSKEPDWIW
NCMDRWLASLDSIVKGKIESKPNSTVLQKQRELMRSIDYVREIAWLRSVIEAGDYPVVFC
HNDLQEGNILLRQSNNGNDRTPRESISSLRSNFDETLGDSLDGNSNLDADDNKSHSASPC
PELDTTDDSALDSSFMSDHEPDLIIIDFEYCAYNYRGFDLANHFIEWTFDYTNPQFPYFH
HYKHQYAPVQQRRDFIVNYLKKYHDDEHYEPHMEELDAVDAEIQLFTMLSHLFWSLWSVV
NVTSAIEFGYWEYGIARILEYQQLKSAYLGK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgtaaaggttgcattaaacaaaaaactcgtcgtcaaaagcagcagaaattt
ctagatattgatcaaaattgttgtaaacgtccacgctgtaattatgaacatatctggcaa
cattttcgacgcaatgccacacttgaggaaattcgccaagcggctgcgcgcatttgccgt
gactatctaaccggacgctggaaggtggttaccccagagcaattggtggtaaagcgcatc
agcggtggtctctcgaatttcttgtattacgtcagtttgcccgacttggatgattttgat
gaacagcaattgttggaggtagagcagcagcaacagcagacaggaaatgtcaacgtcaac
attggcaaacacgtcatagccgcctcggcatttgctaagaatagcgaaaacaacaacaac
aataataataacaataacaacaacaacaatatcaaagatgtggcaccggaggtaacaaaa
aatccctcagccatcacccacgccgatgatgatgatgacgatgcggcgctgagcgctaaa
caggcaaataaaagacgacgctttgatagcgacagcggcgatagtttgctgcgacgtttg
cacagtcccaagcaggaaccccgtgaggtgctgctgcgcatctatggtcaaacgcatggc
gatcatgccctggagaccatgataacagagtctgtggtatttgccctgctcagcgaacgt
aactttggaccgaagctgcatggcatatttcccggtggacgcattgagcaatatataccg
gcacgcacattgaccaccacagagctgggcgatgctcgtatttcgatgaagatagctgag
aaaatgggtgaaatacacagcttgaatataccaatgtcgaaggaaccggactggatatgg
aattgcatggaccgttggctggccagcttggatagcattgtaaagggcaaaattgaatcg
aaaccgaattcgacagtattgcaaaagcaacgtgaactcatgcgatccattgactatgtt
cgggaaatagcctggctaagatcggtgatagaagcgggcgactatcccgttgtcttttgc
cacaacgatctgcaggagggcaacatattattgaggcaatcaaacaatggaaatgaccgt
acacccagagaatcgataagtagtctaagatccaattttgatgagaccctgggcgatagt
ctggatggcaacagtaatttggatgcggatgacaataagtcgcatagtgcgtcaccctgc
ccggaattggacaccacggatgattccgcactggactcgagctttatgtccgatcatgag
ccagatctcattatcattgattttgaatattgcgcctacaattatcgtggcttcgatttg
gctaatcatttcattgagtggaccttcgactacaccaatcctcaattcccatactttcac
cactacaaacatcaatacgcaccggtgcagcaacgtcgtgattttatcgtcaactatttg
aagaaatatcacgatgatgagcactacgagccccatatggaggagctcgatgcggtcgat
gccgaaatacaactatttacaatgctctctcatctattctggagcctctggtctgtggtg
aatgttacgtcagccattgagtttggttattgggaatatggcatcgcacgcatactggag
taccagcagttgaagtccgcctatttgggaaaatga

DBGET integrated database retrieval system