KEGG   Drosophila mojavensis: Dmoj_GI12154Help
Entry
Dmoj_GI12154      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00564  Glycerophospholipid metabolism
dmo01100  Metabolic pathways
Module
dmo_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmoj_GI12154
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dmoj_GI12154
    2.7.1.82  ethanolamine kinase
     Dmoj_GI12154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH Toxin_8
Motif
Other DBs
NCBI-GeneID: 6576555
NCBI-ProteinID: XP_002002544
FlyBase: FBgn0134911
UniProt: B4KF17
Position
Unknown
AA seq 571 aa AA seqDB search
MRQRKGCIKQKTRRQKQQKFLDIDQNCCKRPRCNYEHIWQHFRRNATLEEIRQAAARICR
DYLTGRWKVVTPEQLVVKRISGGLSNFLYYVSLPDLDDFDEQQLLEVEQQQQQTGNVNVN
IGKHVIAASAFAKNSENNNNNNNNNNNNNNIKDVAPEVTKNPSAITHADDDDDDAALSAK
QANKRRRFDSDSGDSLLRRLHSPKQEPREVLLRIYGQTHGDHALETMITESVVFALLSER
NFGPKLHGIFPGGRIEQYIPARTLTTTELGDARISMKIAEKMGEIHSLNIPMSKEPDWIW
NCMDRWLASLDSIVKGKIESKPNSTVLQKQRELMRSIDYVREIAWLRSVIEAGDYPVVFC
HNDLQEGNILLRQSNNGNDRTPRESISSLRSNFDETLGDSLDGNSNLDADDNKSHSASPC
PELDTTDDSALDSSFMSDHEPDLIIIDFEYCAYNYRGFDLANHFIEWTFDYTNPQFPYFH
HYKHQYAPVQQRRDFIVNYLKKYHDDEHYEPHMEELDAVDAEIQLFTMLSHLFWSLWSVV
NVTSAIEFGYWEYGIARILEYQQLKSAYLGK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgtaaaggttgcattaaacaaaaaactcgtcgtcaaaagcagcagaaattt
ctagatattgatcaaaattgttgtaaacgtccacgctgtaattatgaacatatctggcaa
cattttcgacgcaatgccacacttgaggaaattcgccaagcggctgcgcgcatttgccgt
gactatctaaccggacgctggaaggtggttaccccagagcaattggtggtaaagcgcatc
agcggtggtctctcgaatttcttgtattacgtcagtttgcccgacttggatgattttgat
gaacagcaattgttggaggtagagcagcagcaacagcagacaggaaatgtcaacgtcaac
attggcaaacacgtcatagccgcctcggcatttgctaagaatagcgaaaacaacaacaac
aataataataacaataacaacaacaacaatatcaaagatgtggcaccggaggtaacaaaa
aatccctcagccatcacccacgccgatgatgatgatgacgatgcggcgctgagcgctaaa
caggcaaataaaagacgacgctttgatagcgacagcggcgatagtttgctgcgacgtttg
cacagtcccaagcaggaaccccgtgaggtgctgctgcgcatctatggtcaaacgcatggc
gatcatgccctggagaccatgataacagagtctgtggtatttgccctgctcagcgaacgt
aactttggaccgaagctgcatggcatatttcccggtggacgcattgagcaatatataccg
gcacgcacattgaccaccacagagctgggcgatgctcgtatttcgatgaagatagctgag
aaaatgggtgaaatacacagcttgaatataccaatgtcgaaggaaccggactggatatgg
aattgcatggaccgttggctggccagcttggatagcattgtaaagggcaaaattgaatcg
aaaccgaattcgacagtattgcaaaagcaacgtgaactcatgcgatccattgactatgtt
cgggaaatagcctggctaagatcggtgatagaagcgggcgactatcccgttgtcttttgc
cacaacgatctgcaggagggcaacatattattgaggcaatcaaacaatggaaatgaccgt
acacccagagaatcgataagtagtctaagatccaattttgatgagaccctgggcgatagt
ctggatggcaacagtaatttggatgcggatgacaataagtcgcatagtgcgtcaccctgc
ccggaattggacaccacggatgattccgcactggactcgagctttatgtccgatcatgag
ccagatctcattatcattgattttgaatattgcgcctacaattatcgtggcttcgatttg
gctaatcatttcattgagtggaccttcgactacaccaatcctcaattcccatactttcac
cactacaaacatcaatacgcaccggtgcagcaacgtcgtgattttatcgtcaactatttg
aagaaatatcacgatgatgagcactacgagccccatatggaggagctcgatgcggtcgat
gccgaaatacaactatttacaatgctctctcatctattctggagcctctggtctgtggtg
aatgttacgtcagccattgagtttggttattgggaatatggcatcgcacgcatactggag
taccagcagttgaagtccgcctatttgggaaaatga

DBGET integrated database retrieval system