KEGG   Drosophila mojavensis: Dmoj_GI12195Help
Entry
Dmoj_GI12195      CDS       T01062                                 

Definition
GI12195 gene product from transcript GI12195-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dmoj_GI12195
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI12195
Transcription factors [BR:dmo03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dmoj_GI12195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1039 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVNDLSALITTSNRKMDKSTVLKSTIAFLKN
HNEATDRSKVFEIQPEWKPTFLTNDEFTHLMLESLDGFMMVFSSMGSIFYASESITSQLG
YLPHDLYNMSIYDLAYEMDHEALLNIFLNPTPVIEPRQTDISASNQITFYTHLKRGGLEK
VDANSYELVKFVGYFRNDTSAHSDSPSNSSQLTLPRIFQQHPGVELDRKLVFVGTGRIQT
PQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYHFDDLD
SIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYYVSYHQYNSKPDYVVCTHKVVSHA
EVIKQSHKDRQKPTKPLNSSSSSKCASATTTLRDFELGNQNLDSALLGNTLASLSNEVAA
ATSPTVDSSPMWSTGAAPAASTCQLNSVKTSRPASSYGNISSTGISPKAKRKCYFYNRGN
ESDSTSMSADSVISRQSLMTHVSSQSQRHRSHHQQQRQQQQQQQQQHQQQHPQQQQQQQQ
QQQQQQQNSHSQQQQQQQLQHQQLTQHHLHQQQLQLQQGTAAPKILPMPLATTQIVTSNA
CQFPQSSYPLTSPQLVAPSFLEPPQYLAAIPMQPVMAPFPVAPVLSPLPMQTQSELLPGA
VVMTSTQSQLQDQLQRKHDELQKLIMQQQNELRIVSEQLLLARYTYLQPMMPMGFAASNM
AVAAAAVEGNSAGNHVQRNFNFSGSNAVEPQFNQYGFALNSEQMLNQQDQQMMMQQQQNL
HNQQQHNHSLQQQQPQQSQQQLQLQQSQTQQQQQQQQQQLQLQQHSQSNILSREDIEDID
AFLNLSPLQSLNQLNNSNANSNANASGNNNNANNASNSNSNSNNNGNSNNSNSNTNNNNN
NNSNAPENTNEDSLLSYMQMATESGASLNFHMGISDDGSETHSEDNKLMRSTSSNQQQQQ
QQQQQQQQQLLQPQPVVAQQLLQTQQQQQQQQSNFFAANPFGSSTQSQLANDLEILPYPI
GQEETQSLFSSPHTANSSQ
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaaagcgatgataaggatgacacgaaaagaaagtcccgcaatttgagcgag
aagaagcgccgggatcagttcaattcgctggtgaacgatttgagtgcattgataaccaca
tcgaatcgcaaaatggacaaatccacagtgctcaaatccacaatagcattcctaaagaat
cacaatgaggcaacggacagatcgaaggtctttgagatccagccggaatggaagcccacg
tttctcacaaatgacgaattcacgcacctcatgctggagtctctggatggcttcatgatg
gtgtttagcagcatgggctccatattctatgcgtcggagagcattacctcgcagctgggc
tacttgccgcatgacctgtacaacatgagcatctatgatctggcttacgaaatggatcac
gaggccttgctgaacatcttcttgaatcccacgcccgtcatcgagccccgccagacggac
atcagcgccagcaaccagattaccttctacacgcatctgaagcgcggcggcctggagaaa
gtcgatgccaactcctatgagctggtgaaattcgtgggctactttcgcaacgacaccagc
gcccactcggacagcccgagcaacagcagtcagctgacgttgccgcgcatctttcagcag
catccgggcgttgagctggacaggaagctggtctttgtgggcacgggacgcatacagacg
ccgcagctgatacgcgagatgagcatcatcgatcccaccagcaacgagttcacctcgaag
cacagcatggagtggaagttcctcttcctcgaccatcgggcgccgcccattatcgggtac
atgcccttcgaggtgctgggcacctcgggctatgactactaccacttcgacgacctggac
agcattgtggcctgccacgaagagttgcgccagacgggcgagggcaagtcctgctactac
cgcttcctgaccaagggccagcagtggatttggctgcagacggactactacgtgagctac
caccagtacaactcgaagccggactacgtggtgtgcacgcacaaggtggtcagccatgcg
gaggtcatcaagcagagccacaaggaccgacagaagcccaccaagcccctcaactcctcc
agcagcagcaagtgcgcctcggcgacgaccacgctgcgcgactttgagctgggcaaccag
aacctggacagcgcgctgctcggcaatacgctggccagcctgagcaacgaggtggccgcc
gccacgtcgcccactgtcgactcgtcgcccatgtggtcgacgggcgcggctcctgctgcc
agcacctgccagctgaactcggtgaagacgtcgcggcccgcttccagctacggcaacatc
agctccacgggcatctcgccgaaagccaagcgcaagtgctacttctacaacagaggcaac
gagtccgactccacctccatgtccgcagattctgtgatcagtcgccagtcgctgatgacg
catgtcagctcgcaaagtcagcggcatcgttcgcatcatcagcagcaacggcagcagcag
cagcagcaacaacagcagcatcagcaacagcatccgcagcagcagcagcaacaacagcag
cagcagcagcagcagcagcaaaactcacactctcagcagcagcagcagcaacagttgcag
catcaacagctcacccagcaccatctgcaccagcaacagttgcagctgcagcagggcact
gctgcgcccaaaatcctgcccatgccgttggcaaccacccagattgtcacgagcaacgcc
tgccagtttccacagtccagctatccgctgaccagtccccagctggtggcgcccagcttc
ttggagccaccgcagtacctcgcagccatacccatgcagccggtgatggcgccgtttcct
gtggcgccagtcctgtcgccgttgcccatgcagacgcagtcggagctgctgccgggcgcc
gttgtcatgacctccacgcagagccagctgcaggatcagctgcagcgcaagcacgacgag
ctgcagaagctgatcatgcagcagcagaacgagctgcgcattgtctccgagcaactgttg
ctggcgcgctacacctatctgcagcccatgatgcccatgggcttcgctgccagcaacatg
gccgttgctgctgccgccgtcgagggcaactcagccggcaaccatgtgcagcgcaacttc
aacttcagcggcagcaatgctgtggagcctcagttcaatcagtatggcttcgctttgaac
tcggagcagatgctcaatcagcaggaccagcagatgatgatgcagcagcagcagaatctg
cacaatcagcagcagcacaatcacagcctgcagcagcagcagccgcagcagagtcagcaa
cagctgcagctgcaacagagccagactcaacagcaacagcagcagcagcagcaacagttg
cagctgcaacagcacagccagagcaacatattgtcgcgggaggatattgaggacatcgat
gccttcctcaatctgtcgccgctgcagtcgctgaatcagctcaacaacagcaatgccaac
agcaatgccaacgccagcggcaacaacaacaatgccaacaatgccagcaatagcaacagc
aacagcaacaacaatggcaacagcaacaacagcaactccaacactaacaacaacaacaac
aacaactcgaatgctccagagaacacaaatgaagactcgctgctctcctacatgcaaatg
gccaccgagtcgggcgcctcgctcaactttcacatgggcatcagcgacgacggctccgag
acgcacagcgaggacaataagttgatgcgcagcaccagcagcaatcagcagcagcaacag
cagcaacagcaacagcagcagcagcaactgttgcagccgcaacctgtagtggcgcagcaa
ctgttgcagacgcaacagcagcagcaacaacaacaaagcaacttctttgctgcaaatccc
tttggcagctcgacccagagtcagctggcaaacgatctggagatcctgccatatccaatc
gggcaggaggaaacacaaagtctgttcagctccccccacactgcgaacagtagtcaatag

DBGET integrated database retrieval system