KEGG   Drosophila mojavensis: Dmoj_GI12214Help
Entry
Dmoj_GI12214      CDS       T01062                                 

Definition
GI12214 gene product from transcript GI12214-RA
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dmo  Drosophila mojavensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dmo03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dmo03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 492 aa AA seqDB search
MADTKSGRHASTSAATPLLVQSPENLECKNFQEYLRTRQTPESLEKLYSYPPICLAVFRE
LPEIARQFVIRILFVDQPVPQAVVSSWGAQRVAKEQLEATNCLSALSVWRVTAIPGGLAA
WELSPTFKKSVRQVLLGGGKPWAITNSLERDSKPRDVAFLDAYAMSRWRCVLHYMVGTGN
RSNTETEAISPDAVRILLHANLMKRDEREGITITRQGFQFLLLDTRAQVWHFMLQYLDTC
QERGLVLAECLSMLFQLSFSTLGRDYSSEGMNKQMLMFLQHLREFGLVFQRKRKEHRFYP
TRLALNVTNKEAAEASISVDEERMQERGYIVVETNYRVYAYTDSQLQVAVLGLFTELLYR
FPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMKLVESAIQSKSCLPPTVVDQI
KLWEMERNRFTYTEGVVYNQFLSQNDFVTLRDYAQSQNVLVWQNERTRTMVVQKNGHDDV
KRYWKKYSKSAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacaaaatccggccgtcatgcgagcaccagcgctgcaactccacttctggtg
cagagccccgagaacctggagtgcaagaactttcaggaatatctgcgcacccgccagaca
cctgaatcattggagaagctctacagttatccacccatttgcctagctgtcttccgcgag
ttgcctgaaattgcaagacaatttgtgattcgtatactgttcgtcgaccaacccgtacca
caggccgttgtcagctcatggggcgcccaacgtgtggccaaggaacaactggaggcaacc
aactgcttgtctgccttatctgtttggcgtgtgacagccataccaggtggactagctgcc
tgggagctatcgcccacatttaagaagagcgtgcgccaagtgttgttaggtggaggaaag
ccctgggcaattaccaattcgctcgagagggactccaagccacgggatgttgcattcctt
gacgcgtatgccatgtctcggtggcgttgtgtgctgcattacatggtgggtacgggaaat
cgaagtaacaccgaaactgaggccatcagtccagatgccgtacgcattctactccatgca
aatcttatgaagcgcgatgagcgggagggcattaccatcacacgtcaaggatttcagttc
ttgcttctggacacacgagcccaggtctggcatttcatgctgcagtatttagatacgtgc
caggaacgtggcctggtcttggccgagtgtctgtctatgctctttcaattgagcttctct
acgctggggcgcgactacagctctgaaggcatgaacaagcagatgctgatgtttctccag
cacctgcgggagttcggcctggtatttcaaaggaaacgcaaagagcatcgcttttatccc
acgcgattagcgttaaatgtaactaacaaggaagcagcagaagcatccatttcggtggat
gaagagcgcatgcaggagcgaggctacattgtggtggagaccaactatcgcgtatatgcc
tacacagactcccagttgcaggtcgctgtgctgggccttttcaccgagctgctctatcga
tttcccaatctcgtagtaggcgtgctcacccgagactctgtgcgtcaagctctgcgaggc
ggcattacggccgagcaaatagtcagctatttggagcagtatgcacatcccaacatgaaa
ttggttgagtctgcaattcaatcaaaatcctgcctgccacccaccgtcgtggaccaaatc
aaactgtgggagatggaacgcaatcgtttcacctacaccgagggcgtcgtctacaatcag
ttcctctctcagaatgacttcgtaacgctgcgcgactacgcccaatcccagaatgtgttg
gtctggcaaaacgagcgcacccgcaccatggtcgtgcaaaagaatggccacgacgatgtc
aagcgctattggaagaagtactcaaagagcgccggctag

DBGET integrated database retrieval system