KEGG   Drosophila mojavensis: Dmoj_GI12238Help
Entry
Dmoj_GI12238      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dmo  Drosophila mojavensis
Pathway
dmo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmoj_GI12238
Enzymes [BR:dmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmoj_GI12238
Chaperones and folding catalysts [BR:dmo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dmoj_GI12238
Membrane trafficking [BR:dmo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dmoj_GI12238
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dmoj_GI12238
  Exosomal proteins of colorectal cancer cells
   Dmoj_GI12238
  Exosomal proteins of bladder cancer cells
   Dmoj_GI12238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 OST3_OST6 Thioredoxin_2 Thioredoxin_7 AhpC-TSA Redoxin TraF ERp29_N Thioredoxin_9 Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 6581995
NCBI-ProteinID: XP_002007708
FlyBase: FBgn0134995
UniProt: B4L127
Position
Unknown
AA seq 493 aa AA seqDB search
MKFLICALLAASYVAAADIKLEEGVIVATVDNFKQVITDNEFVLVEFYAPWCGHCKALAP
EYAKAAQQLAEKESPIKLAKVDATVEGDLAEQYQVRGYPTLKFFRSGSPVDYNGGRQAAD
IIAWVTKKTGPPAKDLTSVADAEQFLQDNEIAIIGFFKDVESAEAKVFTKAANALDSFVF
GITSNADVIAKYEAKDNGVILFKPFDEKKSVFEGELNEENLKKFAQVQSLPLIVDFNHES
AAKIFGGSIKSHLLFFVSKEAGHIEAHVDPLKEIAKKYREDILFVTISSDEEDHTRIFEF
FGMNKEEVPTIRLIKLEEDMAKYKPETNDLSVESIEAFLQKFLDGKLKQHLLSQELPEDW
DKQPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYEQLAEKYKDNADIVIAK
MDSTANELENIKISSFPTIKYFRKDDNKVIDYNLDRTLDDFVKFLDANGEVADAEPTEES
EEEEEAAPKKDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctaatctgtgcattgctcgcggcgtcctacgtggcggccgctgatattaaa
ttggaggaaggtgtcattgtagcaacggtagacaatttcaaacaagtgattaccgacaat
gaatttgtgctcgtcgaattctatgcaccatggtgtggacactgcaaggctctggcgccc
gagtatgccaaggctgcccaacagttggccgagaaggaatcgcccattaagctggctaag
gttgatgcaaccgttgagggtgacttggccgagcagtatcaggtgcgtggctatcccacg
ctgaagttcttccgcagcggctcgcccgtggattacaatggtggacgtcaggccgcggac
attattgcctgggtgaccaagaaaactggcccaccagccaaggacttgaccagcgtggct
gatgccgagcagttccttcaggacaatgagatcgccattattggcttcttcaaggatgtt
gaatcggctgaggccaaggtcttcaccaaggctgccaacgcattggattcgttcgtcttt
ggtatcaccagcaatgccgatgttattgccaaatacgaggctaaggacaatggtgtcatt
ctcttcaagccattcgatgagaagaaatccgtgttcgagggagagctgaatgaggaaaac
ctcaagaaattcgctcaggtgcaatctctgcctttgattgttgacttcaaccatgagtca
gctgccaagatcttcggcggctccatcaagtcgcatctgttgttctttgtttccaaggag
gctggccacattgaggcccatgttgacccactgaaggagattgccaagaagtaccgtgaa
gatattctgttcgtcaccatctcgtccgatgaggaggatcacactcgcatctttgagttc
ttcggaatgaacaaggaggaagtgccaaccatccgtttgatcaagttggaggaggatatg
gccaaatacaagcctgaaacgaatgatctgtcggtcgaatccattgaagcattcctgcag
aagttcctcgacggcaaactgaagcagcatttgctctcacaggagctgcccgaggattgg
gacaagcaacccgtcaaggttctcgtgtctagcaacttcgagagcgtcgccttggacaag
agcaagtccgttctggttgagttctatgctccatggtgcggtcactgcaagcagctggct
cccatctacgaacagctggccgagaagtacaaggataatgccgacattgtcattgccaaa
atggactccactgccaacgagctggagaacatcaagatctcatccttcccaacaatcaaa
tacttccgcaaggatgacaacaaagtcatcgactacaatctggacaggactttggatgat
ttcgtcaagttcctagacgccaacggcgaggtggctgatgccgaacccaccgaggagagc
gaagaggaagaggaggcggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system