KEGG   Drosophila mojavensis: Dmoj_GI12253Help
Entry
Dmoj_GI12253      CDS       T01062                                 

Definition
GI12253 gene product from transcript GI12253-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dmo  Drosophila mojavensis
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dmo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 817 aa AA seqDB search
MEVIDGARLGSICYHPSILPRHRGASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLQRQ
TNLEPTDTLDTIYKRFLYPEGVKAMGLAVDMVADGTAPKIVQTEVGATYDPAMFKVENQQ
ICLAQSAVGIFNFVRGLDSVPGAVATVVLDDGTEEQVRLFGAHLYSAGPVKDGKALKLKG
LAKPAWVHEGGLLIEGTDGAFVNVRRIKRGTKMINAGDWFKQAEHQPITDFSEDELAKKV
QLASIWQAILKAPIEGATDFFAAGAGSMDVVRLVEEVKDAFDVPLENENVFMAPVFDEFF
DQLVRNLRQGSGGAGGKQVEYKGFQLKANKRDIRVPTQLFINGEFVDAEKNRVLDIVNPT
DETVLCEVACASVNDVDKAVQAAHKAFFGSWKQVSARQRGQLMLKLADLMEQYKEDLATI
ESVDSGAVYTLALKTHIGMSIDAWRYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGV
CGLVTPWNYPLMMLSWKMAACIAAGNTCLIKPAQTCPLTALKFAELSVLAGFPPGVINVL
PGKGSDAGQAVADHPLVRKLGFTGSTPIGKHIMKSCADSNLKKCSLELGGKSPLVIFADC
DLDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFVRRVLKDLRSMTIGDPLNRSTAH
GPQNHKAHMDKLIEYCERGVAEGAKLVYGGCRVPNMKGYFFTPTVFTDVEDNMFIAQEES
FGPIMIISKFNGSDVDSVMTRANRSEYGLASGVFTKDISKALSFADRIEAGTVFVNVYNK
TDVAAPFGGFKQSGFGKDLGQEALNEYLKTKCVTIEY
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgattgacggcgctcgcctgggcagcatttgctatcatccatccatattgccc
aggcatcgcggcgccagcgccatatcctggacgctgattgagggcgatgaggtcgctggc
ttcagtattttctgggccgatgatggcttggacacaggcccattgctgctgcagcgtcaa
acgaatctcgagcccacagacaccttggacaccatatacaagagattcctctacccagag
ggcgtgaaggccatgggcttggctgtggacatggtagccgatggcacagcgcccaagata
gttcagactgaggtgggcgccacctacgatccagccatgttcaaggtggagaatcaacag
atttgcctcgctcagtcggctgtaggaattttcaattttgtgcgcggcttggactcggtg
cctggagcggtagccacagtggtgctcgacgatggcaccgaggagcaggtgcgtctcttt
ggcgcccatctctattcggcgggacccgtcaaggatggcaaagcgcttaagctgaagggt
ttggccaagcctgcctgggtgcacgagggcggcctcctgatcgagggcaccgacggcgcc
ttcgtcaatgtgcgtcgcatcaagcgtggcaccaaaatgatcaatgccggcgattggttc
aagcaggctgagcatcagcccatcacggactttagcgaggacgagctggccaagaaggtg
cagctggcgagcatttggcaggccatcctaaaggcgcccattgaaggagctacggatttc
tttgccgctggcgctggctcaatggatgtggtgcgtctggttgaggaggtcaaggacgcc
tttgatgtgccgctggagaatgagaatgtgtttatggcgcccgttttcgacgagttcttc
gaccagcttgttcgcaacttgcgtcagggcagcggcggtgccggtggcaagcaggtggag
tacaagggcttccagctgaaggcgaacaagcgcgacattcgagtacccacacagctgttc
atcaatggcgaatttgtggatgccgaaaagaatcgtgtgctggatattgtgaatcccacc
gatgagacggtgctctgcgaggtggcctgtgccagcgtcaacgatgtggacaaggcggtg
caggccgctcacaaggctttctttggctcctggaagcaagtgtcggccaggcaacgcggt
caactcatgttgaagctggccgatttgatggagcagtacaaagaggatttggctaccatt
gagtccgttgactcgggcgctgtctacactctggcgttgaagacccacatcggcatgtcc
attgatgcctggcgctacttcgctggctggtgcgataaaattcagggaaatacgataccc
gtgaatccggctagacccaataatgttttgacgtttacgcgcaaggaaccgatcggtgtc
tgtggcctggtcaccccctggaattatcccctgatgatgctctcctggaagatggctgcg
tgcatagcggccggaaatacctgcctgattaagccagctcaaacgtgtcccctgactgct
ctgaagtttgccgaactatcagtcttggccggctttccgcctggtgtgatcaatgttctg
cccggcaaaggctccgatgcgggtcaagctgttgccgaccatcccttggtgcgcaaattg
ggcttcacgggctctacgcccattggcaaacacattatgaaatcctgtgcggactccaat
ttgaagaaatgctcactggagctgggcggcaaaagtcctttggtcatattcgccgactgc
gatctagacaaagctgtgaagcacggcatgtcctctgtcttctttaataagggtgagaac
tgcatagcggctggccgtcttttcgttgaggatcgcattcatgatgagtttgtgcgccgt
gtcttaaaggatctgcgctcaatgaccattggcgatccgcttaatcgctctacagcgcac
ggaccacagaatcataaggcgcacatggacaaattgatagaatactgtgaacgcggtgtg
gccgagggcgccaagctcgtctatggcggctgtcgtgtgcccaatatgaagggctatttc
tttacgcccaccgtcttcacagatgtcgaggacaatatgttcatagcccaagaggaatcc
tttggtcccatcatgatcatatccaaattcaatggcagtgacgtcgactcggtgatgacg
cgtgccaatcgctcggaatatggcctagccagcggcgtcttcaccaaggacattagcaag
gctttaagctttgccgatcgcatcgaggccggcaccgtcttcgttaatgtctataataaa
acagatgtggctgctccctttggcggcttcaagcagagcggcttcggcaaggatctcggc
caggaggcactaaacgagtatctgaagaccaagtgcgttacgattgagtactga

DBGET integrated database retrieval system