KEGG   Drosophila mojavensis: Dmoj_GI12473Help
Entry
Dmoj_GI12473      CDS       T01062                                 

Definition
GI12473 gene product from transcript GI12473-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dmo  Drosophila mojavensis
Brite
Ribosome [BR:dmo03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dmoj_GI12473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 203 aa AA seqDB search
MLPLARGIYSSLAQITRNSRAALHTAGALRCKAEPAAETETPADGEENSENTANAAPDPK
DRKNVIPVETSIRYLKSAAYKTTYGDEFVWTQYRRNHKGMYAPRKTRKTCIRQGRISTGN
PCPICRDEYLVLDYRNTELLKQFISPYSGQVLSYSKTGLCQKSHLRLTVAVEQARDCGLI
TYDVPFREYDYSEYYGKKEESKQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctttagcacgcggcatttacagcagtttggcacaaataacacgcaacagtcgt
gcagcattacacacagccggagcgttgcgttgcaaagcagaaccagccgccgaaactgaa
acacctgcagatggagaagaaaattctgaaaatactgctaatgccgctccagatccaaag
gatcgcaaaaatgtcataccggtggagacctcgatccgctatctaaaaagcgcagcatac
aaaacaacttatggcgacgagtttgtgtggacacaatatcgtcgcaatcataagggcatg
tatgcgccgcgcaagacccgcaagacctgcatacgccagggcagaatcagcaccggaaat
ccttgtcccatctgtcgagatgagtatcttgtgctggactatcgcaacacggagttgctg
aaacagttcatctcgccgtatagcggccaagtgctcagctactccaagacgggtctctgc
cagaagagtcatttgcgtctgactgtcgccgtggagcaggcacgtgattgtggtctaatc
acctacgacgtgcccttccgagagtacgattacagcgagtactatggaaaaaaagaggaa
tccaagcagtaa

DBGET integrated database retrieval system