KEGG   Drosophila mojavensis: Dmoj_GI12640Help
Entry
Dmoj_GI12640      CDS       T01062                                 

Definition
GI12640 gene product from transcript GI12640-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 429 aa AA seqDB search
MHQSIWGWSLPLLFLLILGTPAISSRVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEP
IFALVAQALHATNVRVGRLDCTKYPAAAREFKVRGYPTIMFIKGNMEFIYNGDRSKDELV
DYALRMSGPPVQLVTRTDSVDMLKGSHTIFFMFVGPQQGVVWDTYYAAAEGYQEHGFFYA
TSEEIAAQHFDFEKLPAVIVYKEEQHHFYPHGHVAHEMDPNDVNETIFQWVNVERFTLFP
KVTRFNIHQLLKTKKFLVLAVVQEDKLSQIATHELEFRDMVEGVIRKHRPRYHDKFQFGW
IGDPSIAHSIILDQLPTPHLIALNSTTQHHYIPDDDPLQMTPQALHLFLESISNESATAY
GGDTYFVRVNRALFELKRSLREMWRGNPVLMTVIFGLPLGFLSLIIYSIFCGDCLVTEEE
HEEDHEKKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaatcaatatggggctggagtcttccattgctgtttctgttgatcctcggcacg
ccggccatatcgtcgcgtgtccttgagctgagcgatcgcttcatcgatgtgcgccatgaa
ggtcaatggttagtgatgttctatgccccgtggtgcggctattgcaagaagacggagccg
atatttgcgctcgtcgctcaggcgctccatgcgacaaatgtgcgagtgggacgattggat
tgcaccaaatatcctgctgcagcaagggagttcaaagtgcgtggctatcccacaataatg
ttcatcaagggcaacatggagttcatctacaatggggatcgcagcaaggatgaactggtc
gactacgctctgaggatgtcggggccacctgtccagctggtcacgcgcaccgacagcgtg
gatatgctgaaaggctcccatacgatcttctttatgtttgtgggcccccagcaaggcgtt
gtctgggacacgtactatgcagccgccgagggctaccaggagcacggattcttctatgcg
acgagcgaggagatagctgctcaacatttcgatttcgagaagttgcccgctgtcattgtg
tataaggaggagcagcatcatttctatccacacggacatgtggcgcacgaaatggatcca
aatgatgtcaatgaaaccatattccaatgggtcaatgtggagcgtttcacgctgttccct
aaggtcacgcgtttcaatatccatcagctgctgaagacgaaaaagttcttggtgctcgct
gtggtgcaggaggataagctaagtcagatagcgacgcatgagctggagttccgcgatatg
gttgagggtgtcatacgcaagcatcgaccacgttaccatgacaaattccaatttggatgg
attggcgatccgtccatagcgcattccattatactggaccaattgccaacgcctcatttg
atagcgctgaattccacgactcagcatcactatatacccgacgacgatccgctgcagatg
acgccacaggctctgcatctgttcctcgaatcaattagcaatgagagcgccacggcctat
ggcggtgatacgtattttgtacgagtgaatcgggcactctttgagctgaagcgttccctg
cgcgaaatgtggcgcggcaatccggtgctgatgactgtcatctttggcctgccactgggc
tttctgtcgctcatcatatattccattttctgtggcgattgtctggtcacagaggaagag
catgaggaggatcacgaaaagaaggagtag

DBGET integrated database retrieval system