KEGG   Drosophila mojavensis: Dmoj_GI12684Help
Entry
Dmoj_GI12684      CDS       T01062                                 

Definition
(RefSeq) GI12684 gene product from transcript GI12684-RA
  KO
K03259  
translation initiation factor 4E
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI12684
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmoj_GI12684
Messenger RNA biogenesis [BR:dmo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmoj_GI12684
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dmoj_GI12684
Translation factors [BR:dmo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmoj_GI12684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 246 aa AA seqDB search
MLLAKQNSFNMLDSDTEVQADAISSSSQDLKSYSDGELNKATQQQLPQQQQQQQQQQQQQ
QLVHLPFKHPLEHTWTLWYLENDRSKSWEDMQNEITSFDMVEDFWSLYNHIKPPSELKIG
SDYSLFKKGIQPMWEDETNNDGGRWVISIGRCSKLELDKLWLDVLLILIGEAVQHTEEIC
GAVINLRSKSNKISIWTANGHNETAVMEIGYKLRKLLGLPPHNLQYQMHKDSMSKQGSLV
KAAYIL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggccaaacagaacagttttaatatgctggacagcgatactgaggtgcaggcc
gatgcgatatccagttccagtcaggacctcaaatcctactcagatggcgaattaaataag
gcgacacaacaacaactaccacagcagcagcaacagcaacagcagcagcaacagcagcag
cagctggtccatttaccttttaagcatccacttgagcacacctggacattgtggtatttg
gagaatgatcgcagcaagagctgggaggatatgcaaaatgaaataactagcttcgatatg
gtcgaagatttctggagtctatacaatcatataaagccgccttcggagctcaagattggc
agcgattattcgctgtttaaaaagggcatacaacccatgtgggaagatgagacgaacaac
gatggcggtcgttgggtcatcagcatcgggcgctgcagcaaattggagctggacaagcta
tggctggacgtgctgttaatactgattggtgaggctgttcagcataccgaggaaatctgt
ggcgctgtcatcaacttgcgcagcaagagcaacaaaatctcaatttggaccgccaacggg
cacaacgaaacagccgtcatggagattggctacaagctgcgtaaactgctcggcctgccg
ccgcacaatctccaataccagatgcacaaggactcgatgagcaaacagggatcgctggtg
aaagccgcttacatactctga

DBGET integrated database retrieval system