KEGG   Drosophila mojavensis: Dmoj_GI12707Help
Entry
Dmoj_GI12707      CDS       T01062                                 

Definition
GI12707 gene product from transcript GI12707-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmoj_GI12707
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dmoj_GI12707
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI12707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 535 aa AA seqDB search
METGSESADVNMSGPFIGAIDEGTTSARFMIFRAGTDDIVCYHQIEVPSIFVKEGWCEQD
PRVITNTVNECIEGACKKLVALGGKVKDILAIGITNQRESTLIWDKNTGEALANAIIWLD
NRTTSTVEDLLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVATVKRAMDAGDA
MFGTIDTWLMYNLTGGVNGGVHKTDVTNASRTMLMNIETLQWDGNLLKFFGLPRSILPEI
CSSAEHFGVIAAGSLKGIPITADLGDQQAALVGQQCLSKGQAKATYGTGCFLLYNTGPSI
VHSQHGLLTTVGYQLGRKATPYYALEGSVSIAGAAFNWLRDNIGLIQNTGQIETMASMVD
NSLDVYFVPAFNGLYAPYWNQDARGVLCGLSEETTSEHIVRATLEAVCFQVRDILDSMHK
DCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIHVLRAKIAETTALGAAMAAYKTIAPQYNM
EGPLSKSDERDVVKPKINSTERNLRYQKWKMAIERSLNWETSSLAQGERESFDGV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccggcagcgagtcagcggatgtaaacatgagtggtccctttattggcgccatc
gatgagggcaccacatcggcacggtttatgatctttcgggcaggcaccgatgatattgtt
tgctatcatcaaatcgaggtgccgtccatttttgtgaaggaaggttggtgcgaacaggat
ccgcgggtcattaccaacactgtcaacgagtgcattgagggggcatgcaaaaagctcgtt
gcactaggtggcaaagtcaaggatattttggcaattggcattaccaatcagcgcgagtct
acattgatttgggataagaacacgggcgaggcgttggccaatgccattatttggctggac
aatcgcaccaccagcactgtggaggatttgctggagacaataccgaataatgcgcgcaac
attaattatttgcgaccattgtgtggtctgccgctttcgccatacttctcgggcgttaaa
ctgcgctggctgagagataatgtggcgacggtgaagcgagccatggatgcaggagacgcc
atgttcggcaccattgatacctggctgatgtacaatctaacgggtggcgtgaacggaggt
gtgcacaagacagatgtgacaaatgcatcgcgcactatgctaatgaacatcgagacgctg
caatgggatggaaatctgctgaaattcttcggactgccaagaagtattctaccagaaatc
tgctccagcgccgagcattttggcgtcattgctgcgggttcgctgaagggcatacccatc
acagcggatttgggtgatcagcaggcagcgctggtgggtcaacagtgcctgtccaagggc
caagcgaaggccacctatggcaccggttgctttttactgtataatacgggtccatcaata
gttcattcccagcatggattgctcacgacggtgggctatcaactaggtcgcaaggccacg
ccctattatgccctggagggcagtgtgtccattgccggcgccgccttcaattggctgaga
gataatattggcctcatacagaatacgggccaaatcgagacgatggccagcatggtggat
aactcgctggatgtttactttgtgcccgcattcaatggcctgtatgctccttattggaat
caggatgcaaggggcgtgctatgtggcctgagcgaggagacaaccagtgagcatattgtg
agagccacgctggaggctgtttgcttccaggtgcgcgacatacttgattccatgcacaag
gattgcaaaataccactcgctaagctgatggtcgatggcggcatgactgtcaacaatcta
ttccttcagctgcaatccgacctggttggcattcatgtgctgcgcgcaaagattgcggag
accacagcgctgggcgctgcaatggctgcctataagacgattgctccacagtataatatg
gaaggcccgttgtccaaatcggatgaacgcgatgttgtaaagccgaagatcaattccacg
gaacgcaatttgcgctaccagaaatggaagatggccatcgagagatctctgaactgggag
acctcttcgcttgctcaaggcgaacgcgaatcctttgatggtgtttaa

DBGET integrated database retrieval system