KEGG   Drosophila mojavensis: Dmoj_GI12716Help
Entry
Dmoj_GI12716      CDS       T01062                                 

Definition
GI12716 gene product from transcript GI12716-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI12716
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI12716
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI12716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 822 aa AA seqDB search
MEELRKHLSKVNVPCGNPPIYKDECVFSYDNPETPTGLYVCLQSFLGFGEAYVNEYAAKT
GNVVFLHIKRERKLKDGESNVKAQLDEAEAGPERKITRLAIGVEGGYNETDLAKKYEIKD
TYSIVVAPHLDKKLPYPDPELPMRVTQAVEAIIEADSAIAKLEKATLTGTWDGEVRQASK
YAENLQQLDNGKKIPPAGWQCEKCDLTNNLWLNLTDGSILCGRKFFDGSGGNDHAVEHYR
ETGYPLAVKLGTISADGKSDVFSYPEDDMVLDPHLSKHLQHFGINMAAMQKCEKSMVELE
LEINQRIGEWSALTESESELQPLAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQKRFVGS
GADQYFKSFPSDPANDFNIQMAKLGNGLLSGKYSSLVGNTLDMEHMTGISPAMFKNIVGK
NHPEFSTKQQQDANDFYLHLLTLLDRNSRNQFNPADALKFQLEDRVECMASHKVKYKTRE
EYSFRLPIPLEQATNLDEVREYQEREQAARASGQRLPDRELVRHKVPLQACLERFFGNEI
IDQFYSTAINAKTTAKKTTRMATMPDFLMIHLGKFTLGDDWVPKKLDVSVDMPDELDLSV
WRSTGPQPGEELLPEPATAASPAFVFDENVMSELVNMGFPQEACKRACFHTQNIGLEAAS
NWLMEHIADADISDPFEVPNNRIGDGAASAFVANPESLAMLMSMGFGERQATAALKATDG
NVERATDWIFSHADAGIDDAPAAAPACTTAATTAAGSSYRDGSGKYKLVAFISHMGTSAQ
VGHYVCHIRKQGEWVIFNDTKVAKSQNPPKDLGYLYLYMRDE
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctacgcaagcatttatccaaggtaaacgtaccgtgtggcaatccaccaatt
tacaaagatgagtgcgtcttctcctacgacaacccggagacgccgacgggcctctacgtc
tgcctgcaaagcttcctcggcttcggggaggcgtacgtgaatgaatatgccgctaaaacc
ggaaatgttgtgtttttgcacattaaacgcgagcggaaactgaaggatggcgagtccaat
gtgaaggcgcagttggacgaagcggaagccgggccggagcgaaaaattacgcgtcttgcc
attggcgtcgagggcggttacaatgagactgatttggctaagaagtacgagattaaggat
acgtacagcattgtggtggccccccatctggataagaagctgccctatccagatcccgag
ctgcccatgcgtgtcacccaagcggtggaggcaatcattgaagcagattctgccatagca
aagctcgagaaggccacactcaccggcacatgggatggtgaggtgcgtcaggcctcgaag
tacgcagagaatcttcaacagctggacaatggaaagaagataccgccagctggctggcag
tgcgagaaatgcgatctgaccaacaatctgtggctgaatctaacagacggctccatccta
tgtggacgcaagttctttgatggcagcggaggaaatgatcacgcagtagagcattatcga
gagactggctatccgctggccgttaagcttggcaccatttcggccgatggcaaatcggat
gtattctcctacccggaggacgatatggtcttagatccgcacttgagcaagcatttacaa
cactttggcatcaatatggcggccatgcagaagtgtgagaaatccatggtcgagctggag
ctggagattaatcagcgcattggtgaatggtctgcgctgacggagagcgagagcgagctg
cagccgctggccggacctggctatacgggcatgcgaaatctgggcaactcctgctacata
aacagtgtgatgcaggtgctctttgtcatccctgatttccagaagcgtttcgttggcagc
ggcgccgatcagtacttcaagagctttcccagtgatccggccaatgatttcaatatacag
atggccaaactgggcaatggattgctctcgggaaagtacagcagcttggtgggcaacacg
ctggacatggagcacatgacgggcatttcaccggccatgtttaagaatattgtgggcaag
aatcatcccgagtttagcaccaagcagcagcaggacgccaatgatttctatttgcatttg
ttaacgctgctcgaccgcaattcccgcaatcaattcaatccggcggatgctctcaaattc
cagcttgaggatcgtgtcgagtgcatggccagtcacaaagttaaatataagacccgtgag
gagtacagcttccgactgccaattccccttgagcaggccaccaatctggatgaggtgcgc
gagtatcaggagcgagagcaggcagcacgagctagtgggcaacgtctgccggatcgtgag
ctggtgcggcacaaggttccgctgcaggcatgtctggagcgtttctttggcaacgagatc
atcgaccagttctattcgacggccataaatgccaagacgacggccaagaagacgacgcgc
atggccaccatgccggatttcttgatgattcatctgggcaaatttacgcttggcgatgat
tgggtgcccaagaagcttgatgtctcggtggatatgccggatgagctggatcttagtgtc
tggcgctcgactggacctcaaccaggagaggaactactgcctgaacctgcaactgcagcg
tccccggcgtttgttttcgatgagaatgtgatgtcggagctggtcaacatgggcttccca
caggaggcatgcaaacgcgcttgtttccatactcagaatatcggactggaggctgcttcc
aattggctaatggaacacattgccgatgcggatatctccgatccattcgaggtgccaaat
aatcgcattggtgatggcgccgcctccgctttcgttgccaatcccgagtcactggccatg
ctcatgagcatgggctttggcgagcgccaagcgacggccgccctcaaggccaccgatggc
aatgtggagcgagccaccgactggatcttctcgcatgccgacgccggtattgatgatgcg
ccagcggctgcaccagcctgcactacagccgccacaactgcagcggggagctcttatcgc
gatggctccggaaaatataaactggtggcgttcatctctcacatgggcacctctgcccag
gtgggtcactatgtctgccacatacgcaaacagggcgagtgggtgatcttcaacgacacc
aaggtagccaagtctcagaatccacccaaggatctgggctacctgtatctgtatatgcgc
gatgagtaa

DBGET integrated database retrieval system