KEGG   Drosophila mojavensis: Dmoj_GI12742Help
Entry
Dmoj_GI12742      CDS       T01062                                 

Definition
GI12742 gene product from transcript GI12742-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dmo  Drosophila mojavensis
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dmo04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALNVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTAEYLEKI
KNKLFDNLRLLPHAPGVQIQAIPEDAINDESEDEDKVDKDERLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRNYKGQRKRPRLDKEPIISNASSKASAESSEAKDEKEKAEAEGEESAT
ANNTNSSSSNSGGSNSNKDDAATPTAGGGGSGAAAASKGAKENNI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcccatagtaaaaaacgagtttgctattattacgacagtgacattggcaactac
tactatggccaaggccatcccatgaagccccatcgcatacgcatgacccacaatctgttg
ctcaactatggactctatcgtaaaatggagatttatagaccccataaggccacagcggat
gagatgaccaaattccattcagatgaatatgtgagatttttacgttccatacgcccggac
aatatgacggagtataacaaacagatgcagcgcttcaatgtgggcgaagattgtcccgtt
ttcgatgggctctacgagttctgtcaactgtccgccggtgggtcagtggctgcagctgtc
aagctgaacaaacaggcctcggagatctgcatcaactggggaggcggtctgcatcatgcc
aagaaatcggaagcttccggcttttgctatgtcaacgatattgtccttggcatcttggag
ctattgaagtatcatcagcgagtgctctacatcgacatcgatgtgcatcacggcgatggc
gtcgaggaggcattctataccacagatcgggtgatgacggtcagtttccataagtacgga
gaatactttccgggcacgggcgatctgagggatattggcgctggcaagggcaaatactat
gctgtgaatattccgctgcgcgatggcatggacgacgatgcctacgagagcatctttgtg
cccatcatatccaaggtcatggagaccttccagccggcggctgtggtgctgcaatgcggt
gctgactcgctaacgggcgatcgcctgggttgcttcaatctgaccgtcaagggacacggc
aaatgcgtcgagtttgttaagaaatacaacctgcccttcctgatggtcggcggcggcggc
tacaccatccgtaatgtctcccgctgctggacctatgagacgtccgtggctctgaacgtt
gaaattgctaacgaactgccctacaacgattattttgagtatttcggtccggatttcaag
ctccacatcagcccgagcaacatgacgaatcaaaatacagcagaatatctggagaagatc
aagaacaaattgttcgacaatttgaggttgttgccgcatgcgccgggtgttcaaatccag
gccatacccgaggatgcgataaacgatgagtctgaggacgaggataaggtggacaaggac
gaacgcctgccccagagcgacaaggacaaacgcattgtgccggagaacgagtactcggac
tcggaggacgagggcgaaggcggccgtcgagacaatcgcaactacaagggtcaacgcaaa
cgtccaaggctcgacaaggagcccatcatcagcaatgcgagcagcaaagccagcgccgag
agcagcgaggctaaggatgaaaaggagaaggctgaagctgaaggcgaggagtccgccacg
gccaacaatacgaatagcagcagcagcaacagcggcggcagcaacagcaacaaagatgac
gctgccacgcccacagccggcggtggtggcagtggtgccgccgctgcatcgaagggcgcc
aaggagaacaatatatga

DBGET integrated database retrieval system