KEGG   Drosophila mojavensis: Dmoj_GI12840Help
Entry
Dmoj_GI12840      CDS       T01062                                 

Definition
GI12840 gene product from transcript GI12840-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 688 aa AA seqDB search
MKKATEANASDGKALHFQVLCKYEVRQDLVHDFVSYTNDGNCISLLGSKAELVTLELSCK
LSHQLPFPYVVTSWKCENKIRPLDLLAEQVNLQYIYESGNVLEQQHISLDSVYTAIYSQD
VPVPNLIAAKLADHLLPDGQMLMATLNSYGALHLLTKRPEQPAWEHYKNGLDVVATLRDK
LQRPYEVPAAKIKTFRHYQAYMDRSWITMLAWRSVEGGEYVLVLGTAAGSIWTLTLCNNA
STILAHSELQTLLGRICFMQSYEDLLLVSDNNGLVHLYRFSATEGEGLCLVKTLWLRPDH
LGLQQAVITHCPTRDCYYIACCKAAHLLIWCMPRQASGKWLETRLHVGGMKITGFCAVAN
NNYALVTARGQLCLVELSHKPGQLSTSMRSVNVDDTKNELPIGLWCSPNKNFITILSTRN
KEYLFNKAIRRNLVYAHVCKIEESNALAQLDRCLTPSVSMNNWKDLLVEVRLDIFQRTKL
DEYLSYAPIDAFAFENVATEARLQQLQLKYHVLDAIITVQRDQRNPSLLEQTEQEFHLLL
NMIELTHMRLRLQYLSEQKKLTKFQRQSAQCQLAASERIRQQLKQQLLGEKATHVATKSA
LLVEMEEQFEQLQVKLNMKEIRITLEDPNLLCAISYMQLSPSLERHYCTLCGRQVLLEKQ
LLLELYPPGSTLLCPYCHGSYALELLDA
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagctactgaagcaaacgctagcgatggcaaagctctgcattttcaagtcctg
tgtaaatatgaagtcaggcaggatttagtccatgattttgtttcatatacaaacgatggc
aattgtatatcgttgctgggctccaaggcggagctagttactctcgaattaagctgcaag
ctgagccatcagctgccctttccatatgtcgtgaccagctggaagtgtgaaaacaaaata
cgaccactagacctactggcggaacaagtgaatctccagtatatctacgaaagcggcaat
gtgctggagcagcaacacatcagtctggattccgtgtacacagcaatctattcacaggat
gtgcctgtgcccaatctcattgccgccaagctggccgaccacctgttgcccgatgggcaa
atgctaatggccaccttgaacagctatggcgcactacatttgttgactaagcggccagag
caacctgcctgggagcactacaagaatggtctcgatgtggtcgccacactccgggacaaa
ctgcagcgcccgtatgaagtgccagctgcaaagatcaagacatttcgacactatcaggcc
tacatggatcgcagttggataaccatgctcgcttggcgatcagtagaaggcggggaatat
gtgctcgtcctgggcacagctgccggcagtatttggacattgactttatgcaacaatgca
tccacgatcttagcccatagtgaactgcagacacttctcgggcgcatttgctttatgcag
agctacgaggatctgctgcttgtgagcgacaataatggtctagtgcatctctacagattc
agtgccacagagggagagggtctctgcttggtcaagactctttggctgcgcccggatcac
ctgggcctgcaacaggctgtgattacgcactgtccgacaagagattgctattatatagcc
tgctgcaaggcagcgcatttgctcatctggtgcatgcctagacaggcaagtggcaagtgg
ttggagacccgactgcatgtaggtggcatgaagatcacaggtttctgcgccgtcgcgaac
aacaattacgctttggtcaccgcccgcggacagctctgcctggtcgagctcagccacaag
cccggccagctgagcaccagcatgcgctcggtcaacgtcgacgatacgaagaacgaactg
ccaataggcctatggtgcagtcccaacaagaacttcattaccattctctccacccgcaac
aaagagtatctgttcaacaaggcaatacgccgtaatctggtttacgcacacgtctgcaaa
atagaagaaagcaatgcattggcacagctagatcgctgcctcacgcctagtgtgtccatg
aacaactggaaggatctgctggtggaagtgcgtttggatatctttcaaaggaccaagctg
gatgagtatctcagctatgcgccaatcgatgcctttgcatttgagaatgtggccacagag
gcacggctgcagcagctgcagctcaagtaccacgtcttggacgccataattacagtacag
cgtgatcaacgcaatccatctctgcttgagcaaaccgaacaggaatttcaccttctgttg
aacatgattgagctcacgcatatgcgactgcgtctccaatacttaagcgagcagaagaag
ctgaccaaattccagcggcagtcggcgcaatgtcaactggcagccagtgaacgaattcga
cagcagctaaagcagcagctactgggtgagaaggcaacacatgtggcaaccaagagtgcg
cttcttgttgaaatggaggagcaatttgagcagctgcaggtgaagctgaatatgaaagag
atacggataactctggaggatccaaaccttctatgcgcgatctcctatatgcagttgagt
ccttcgctggaacgtcactactgcacgctctgtggacgtcaggttttgctggaaaagcag
ctgcttcttgagctgtacccacccggcagcacgctactgtgtccctactgtcatggtagc
tacgccttggagttattggatgcataa

DBGET integrated database retrieval system