KEGG   Drosophila mojavensis: Dmoj_GI12858Help
Entry
Dmoj_GI12858      CDS       T01062                                 

Definition
GI12858 gene product from transcript GI12858-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dmo  Drosophila mojavensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dmo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dmo00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 877 aa AA seqDB search
MKYAAYYWKVSREGRRVYMDYYYLENGKQIYGVPIGGIGGGSIGRGYAGEFCRFQLRPGI
YEYNVVHANQFIVTIKDHKGCTIFQSLLSRCSTKSFKAKTKTPSTNNNDIDASTDEAEAQ
STKCQLPHCSCSRNRQPLSTWHSNIEDSRCSYTGLYPRAWTEYDLSHYGVRLVCRQISPV
IPHDYKESSLPCAVFVWSVQNVCDQERKVSITFTFKNGTGNKKQDAEGNPEAQLIAEGNA
KGVAIRQTIADMPCSYNLACRVLPEISITRCPQFDPAGSGEQLWAQLKEYGQLNEQPTSE
TLKTKDIGVAVCAQLALKPQASHELEFVLAWDMPKIQFPRKLQTHTRYYTKYFDDSGECG
PRICEYALKHYASWERLIDAWQRPILNDEGLPDWYKCAIFNQLYYISDGGTIWLKCDSSL
GNQLAFDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVSLQYDFKDAIG
AELNDTRKMLYDGKVMPRKIKNCVPHDLGDPDEEPFTLINCYNIHDVNDWKDLNTKFVLQ
VYRDYYVLNELAQAQADNASKFSSIEFIDKESLYEQYSQDNNRKSSADGKQQNRKSASMY
INETNGKVYLMDAMVYLKSMYGACKAIMERTIEYDKDNDGLIENTKMPDQTYDAWVMDGP
SAYCSGLWLAALQAMSVMATLLDQPNDCLRYQDILEKGKRSLEEKLWNGSYYRFDLSHNH
RDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHDGNIGAANGFIANV
SEPSKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFDEAFQTAGGMYKTLSQRIGMNYE
TPEALYGEKRYRSIGYMRPLSIWSMQVAWERRRALRD
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgctgcctactattggaaggtgtcgcgcgaaggtcgtcgcgtctatatggac
tactactacttggagaatggcaaacagatctatggcgtgcccattggcggcatcggcggc
ggcagcattgggcgtggctatgctggagaattctgtcgctttcaattgcgcccgggcatc
tatgagtacaatgtggtgcatgcgaatcagtttatcgtaaccatcaaggatcacaaaggt
tgcaccatatttcagagtttgctctcccgatgcagcacgaaatcattcaaggcaaagaca
aagacaccaagcaccaacaacaacgatattgatgcctcgaccgatgaggccgaggcacag
agcactaaatgtcaactgccccattgcagctgcagccggaaccgccagccgctgagcact
tggcactcgaatatcgaggactctcgctgcagctatacgggtctgtatccgcgcgcctgg
accgaatacgatctctcgcactacggcgtccgtttggtctgtcgccagatctcgccggtt
ataccgcatgactacaaggagtcgagtctgccgtgcgccgtcttcgtgtggtcggtgcaa
aacgtttgcgatcaggagcgcaaggtctccatcacgttcaccttcaagaacggcacgggc
aacaagaagcaggatgcagagggcaatcccgaagcgcagctcatcgccgagggcaatgcc
aagggcgtggccattaggcaaacaattgccgatatgccctgcagctataatctcgcctgt
cgcgtgctgcccgagatcagcataacgcgctgcccgcaattcgatccggctggcagtggg
gagcagctgtgggcccagctcaaggaatacggccagctcaacgagcagcccacgtcggag
acgcttaaaactaaggacataggcgtcgctgtctgcgctcagctagccctcaagccgcag
gcatcgcatgagctggaattcgtgctggcctgggacatgcccaagattcagtttccacgc
aaactgcaaacgcacacgcgctactacaccaaatacttcgatgacagcggcgagtgcgga
ccaaggatatgcgaatatgcattgaagcactatgccagctgggagcgactcatcgatgcc
tggcagcgacccatcctcaacgatgagggcctgcctgattggtacaagtgcgccatattc
aatcagctctactacatctcggacggcggcacaatctggctgaagtgcgactcttccttg
ggcaaccagctggccttcgatgatccgcgcttggcctacggccgctttggctatctggag
ggacatgagtacagaatgtacaatacgtacgatgtgcacttctatgcctcgcccgctctg
gcccatctctggcccaatttgcaagtcagcttgcaatacgacttcaaggatgcaattggc
gccgagctgaatgacacacggaaaatgttgtacgacggaaaagtgatgccgcgcaagatc
aagaattgtgtgccacacgatctaggggatcccgatgaggaacccttcacgctcatcaac
tgctataacatccatgatgtcaatgactggaaggatctcaatacaaagttcgtgctacag
gtttacagggattactatgtgctcaacgagctggcccaggcgcaggcggacaatgccagc
aaattcagctcaatcgagttcatcgacaaggagagtctctacgagcagtacagccaggac
aacaatcgcaagagctcggcggatggcaaacagcagaatcgcaaatctgcttccatgtac
atcaatgagacgaatggcaaggtttatctgatggatgccatggtctatctgaagtccatg
tatggcgcctgcaaggccatcatggagcgcaccattgagtatgataaggataacgacgga
ctcatcgagaacaccaaaatgccggatcagacctacgatgcatgggttatggatggaccg
agcgcctattgctccggcctctggctggctgcactgcaggctatgtctgtgatggccacg
ctcttggatcagccgaacgactgtttgcgctaccaggacatattggagaagggcaagcgt
tcgctggaggagaagctatggaacggcagctactatcgcttcgatttgtcgcacaatcat
cgcgacacgatcatggccgatcagctgtgcggccattggtatttgaagtcgtgcggcttc
gactatgagatctacccgaaggagaatgtgcgcaccgccctgaaacgcatttacgacaac
aatgtgatgggctttcacgatggcaacattggcgccgccaatggcttcatagcaaacgtc
agcgaaccgtcgaagccgggccatgtcgacaacagcaacattcaggcggaggaggtgtgg
ccaggcgttgtctatgccctggccgcaaccatgatacaagagggcatgttcgacgaggcc
ttccagacagccggcggcatgtacaagactctgtcgcaacgcatcggcatgaactatgaa
acgcccgaggcgctctatggcgagaaacgctatcgttccattggctatatgcgacccctg
agcatttggtccatgcaggtggcctgggagcgacgccgtgcgctacgcgactaa

DBGET integrated database retrieval system