KEGG   Drosophila mojavensis: Dmoj_GI12858Help
Entry
Dmoj_GI12858      CDS       T01062                                 

Definition
(RefSeq) GI12858 gene product from transcript GI12858-RC
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dmo  Drosophila mojavensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmoj_GI12858
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dmoj_GI12858
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dmoj_GI12858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 951 aa AA seqDB search
MASGNDAAAGDSASAVYAEQLQQEKEHEREPEPNELTAVPRYGLKLKFDHVWPEKRNQNL
RPSIKQSLPMVPLVCRYAAYYWKVSREGRRVYMDYYYLENGKQIYGVPIGGIGGGSIGRG
YAGEFCRFQLRPGIYEYNVVHANQFIVTIKDHKGCTIFQSLLSRCSTKSFKAKTKTPSTN
NNDIDASTDEAEAQSTKCQLPHCSCSRNRQPLSTWHSNIEDSRCSYTGLYPRAWTEYDLS
HYGVRLVCRQISPVIPHDYKESSLPCAVFVWSVQNVCDQERKVSITFTFKNGTGNKKQDA
EGNPEAQLIAEGNAKGVAIRQTIADMPCSYNLACRVLPEISITRCPQFDPAGSGEQLWAQ
LKEYGQLNEQPTSETLKTKDIGVAVCAQLALKPQASHELEFVLAWDMPKIQFPRKLQTHT
RYYTKYFDDSGECGPRICEYALKHYASWERLIDAWQRPILNDEGLPDWYKCAIFNQLYYI
SDGGTIWLKCDSSLGNQLAFDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPN
LQVSLQYDFKDAIGAELNDTRKMLYDGKVMPRKIKNCVPHDLGDPDEEPFTLINCYNIHD
VNDWKDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYEQYSQDNNRKSS
ADGKQQNRKSASMYINETNGKVYLMDAMVYLKSMYGACKAIMERTIEYDKDNDGLIENTK
MPDQTYDAWVMDGPSAYCSGLWLAALQAMSVMATLLDQPNDCLRYQDILEKGKRSLEEKL
WNGSYYRFDLSHNHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFH
DGNIGAANGFIANVSEPSKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFDEAFQTAGG
MYKTLSQRIGMNYETPEALYGEKRYRSIGYMRPLSIWSMQVAWERRRALRD
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggccagtggcaacgatgcagccgctggggattcggccagcgccgtctatgcagagcaa
ctgcaacaggagaaggagcatgaacgggaaccggaaccaaatgaactaaccgctgtgccg
cgctacggattgaaactgaagttcgatcacgtttggccagagaaacgcaatcagaattta
cggccatcgataaaacaatcgctgccgatggttccgcttgtttgcagatatgctgcctac
tattggaaggtgtcgcgcgaaggtcgtcgcgtctatatggactactactacttggagaat
ggcaaacagatctatggcgtgcccattggcggcatcggcggcggcagcattgggcgtggc
tatgctggagaattctgtcgctttcaattgcgcccgggcatctatgagtacaatgtggtg
catgcgaatcagtttatcgtaaccatcaaggatcacaaaggttgcaccatatttcagagt
ttgctctcccgatgcagcacgaaatcattcaaggcaaagacaaagacaccaagcaccaac
aacaacgatattgatgcctcgaccgatgaggccgaggcacagagcactaaatgtcaactg
ccccattgcagctgcagccggaaccgccagccgctgagcacttggcactcgaatatcgag
gactctcgctgcagctatacgggtctgtatccgcgcgcctggaccgaatacgatctctcg
cactacggcgtccgtttggtctgtcgccagatctcgccggttataccgcatgactacaag
gagtcgagtctgccgtgcgccgtcttcgtgtggtcggtgcaaaacgtttgcgatcaggag
cgcaaggtctccatcacgttcaccttcaagaacggcacgggcaacaagaagcaggatgca
gagggcaatcccgaagcgcagctcatcgccgagggcaatgccaagggcgtggccattagg
caaacaattgccgatatgccctgcagctataatctcgcctgtcgcgtgctgcccgagatc
agcataacgcgctgcccgcaattcgatccggctggcagtggggagcagctgtgggcccag
ctcaaggaatacggccagctcaacgagcagcccacgtcggagacgcttaaaactaaggac
ataggcgtcgctgtctgcgctcagctagccctcaagccgcaggcatcgcatgagctggaa
ttcgtgctggcctgggacatgcccaagattcagtttccacgcaaactgcaaacgcacacg
cgctactacaccaaatacttcgatgacagcggcgagtgcggaccaaggatatgcgaatat
gcattgaagcactatgccagctgggagcgactcatcgatgcctggcagcgacccatcctc
aacgatgagggcctgcctgattggtacaagtgcgccatattcaatcagctctactacatc
tcggacggcggcacaatctggctgaagtgcgactcttccttgggcaaccagctggccttc
gatgatccgcgcttggcctacggccgctttggctatctggagggacatgagtacagaatg
tacaatacgtacgatgtgcacttctatgcctcgcccgctctggcccatctctggcccaat
ttgcaagtcagcttgcaatacgacttcaaggatgcaattggcgccgagctgaatgacaca
cggaaaatgttgtacgacggaaaagtgatgccgcgcaagatcaagaattgtgtgccacac
gatctaggggatcccgatgaggaacccttcacgctcatcaactgctataacatccatgat
gtcaatgactggaaggatctcaatacaaagttcgtgctacaggtttacagggattactat
gtgctcaacgagctggcccaggcgcaggcggacaatgccagcaaattcagctcaatcgag
ttcatcgacaaggagagtctctacgagcagtacagccaggacaacaatcgcaagagctcg
gcggatggcaaacagcagaatcgcaaatctgcttccatgtacatcaatgagacgaatggc
aaggtttatctgatggatgccatggtctatctgaagtccatgtatggcgcctgcaaggcc
atcatggagcgcaccattgagtatgataaggataacgacggactcatcgagaacaccaaa
atgccggatcagacctacgatgcatgggttatggatggaccgagcgcctattgctccggc
ctctggctggctgcactgcaggctatgtctgtgatggccacgctcttggatcagccgaac
gactgtttgcgctaccaggacatattggagaagggcaagcgttcgctggaggagaagcta
tggaacggcagctactatcgcttcgatttgtcgcacaatcatcgcgacacgatcatggcc
gatcagctgtgcggccattggtatttgaagtcgtgcggcttcgactatgagatctacccg
aaggagaatgtgcgcaccgccctgaaacgcatttacgacaacaatgtgatgggctttcac
gatggcaacattggcgccgccaatggcttcatagcaaacgtcagcgaaccgtcgaagccg
ggccatgtcgacaacagcaacattcaggcggaggaggtgtggccaggcgttgtctatgcc
ctggccgcaaccatgatacaagagggcatgttcgacgaggccttccagacagccggcggc
atgtacaagactctgtcgcaacgcatcggcatgaactatgaaacgcccgaggcgctctat
ggcgagaaacgctatcgttccattggctatatgcgacccctgagcatttggtccatgcag
gtggcctgggagcgacgccgtgcgctacgcgactaa

DBGET integrated database retrieval system