KEGG   Drosophila mojavensis: Dmoj_GI13124Help
Entry
Dmoj_GI13124      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00250  Alanine, aspartate and glutamate metabolism
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dmoj_GI13124
Enzymes [BR:dmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dmoj_GI13124
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C44
   Dmoj_GI13124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 6582043
NCBI-ProteinID: XP_002007756
FlyBase: FBgn0135881
UniProt: B4KUK4
Position
Unknown
AA seq 560 aa AA seqDB search
MCGILAIFSANGEAIGATNFQGSEHSLRELAYRQSGKQRHRGPDDTGVLVIEEQGVALVH
ERLAVIGVETGHQPLVSQDGNVALIANGEIYNYVELAEQIGKRLPGYRPRSDCNVIIELY
EEHGQELLQHITGMFSFVLYDRRRRQLLVARDPYGIIPLYMGQDAQDNLWFSSEMKCLMG
VCERLQIFPPGHLAAGTVLQIQPVRYHNPSWRQLTPTRPVNLQELRHQLELAVRSHLQCD
VPFGALLSGGVDSSLIASIAAKIMRERDANYKLRTFSVGMPGSPDFEHARLVAQHIGSQH
TEISFTVEDCLDGLRDLIYHLESYDIATVRCSLPMFYLARHVKSTGIKMILSGEGADEIF
GGYLYFHKAPNYDQFHEEMVTICERLHVSDILRANKVTMSKGLELRVPFLDTQLVNHVMS
IRPQDKIPGALNEFAGERKWRMEKFVLREAFDGDYLPDAVLWRQKEQFSDGVGYALIDAL
PEFAARHVTDAQLQAAEQRFSINPPKTKEAYYYRCIFEEQFPGKAAANTVAKWTPRQDWG
CPEDPSGRAQAAHNQAYGKC
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcttagccatattctcggcgaacggagaagcgattggagcaacaaatttt
cagggcagcgagcacagtttgcgggagttggcctatcggcagagtgggaagcaacggcat
cgtggacccgatgacacgggcgtcctggttatagaggagcagggcgtggctttggtgcat
gaacggctggcggtcattggcgtggagacgggccatcagccgctggtgtcgcaggacggc
aacgttgccctgattgccaacggcgagatctacaactatgtggagctggccgagcagatt
ggcaagcgcttgcccggctatcggcccaggagcgattgcaatgtgatcatcgagctgtac
gaggagcacggccaggagttgctccagcacatcacaggcatgttcagctttgtgctctac
gatcgtcgcagacgtcagctgctggtggcccgcgatccctatggcattattcctctctac
atgggccaggatgcgcaggacaacttgtggttttcctcggaaatgaagtgcctgatgggc
gtgtgcgagcgattgcagatcttcccacctggccatctggcagcgggcacagtgctgcag
atccagcccgtgcgctaccacaatcccagctggcgccagttgacgcccacgcggccggtg
aatcttcaagagctgcgtcaccaactggagctggctgtgcgctcgcatttgcagtgtgac
gtgccctttggagcgctgctctcgggtggcgtggactccagcctgatagcttcgatagct
gcgaagatcatgagggaacgggacgctaactacaagctgcgcaccttctcggtgggcatg
cccggttcaccagacttcgagcatgcacgcctggtggcccagcacattggcagccagcac
acggagatcagcttcaccgtggaggactgcctggatgggctgcgcgatctgatctatcac
ctggaatcatacgatatagccactgtgcgctgcagcctgcccatgttctacctggcccgc
catgtgaagagcaccggcatcaagatgatcctctcgggcgagggcgcggacgagatcttt
ggcgggtatctctacttccacaaggcgcccaactacgatcagttccacgaggagatggtc
acgatctgcgagcggctgcatgtctccgatatattgcgtgccaacaaggtgaccatgtcc
aagggactggagctgcgtgtgcccttcctggatacccagctggtaaaccatgtgatgagc
atacgtccgcaggacaagattccaggtgctcttaatgagtttgcgggggaacgaaagtgg
cgcatggagaagtttgtgctgcgcgaagccttcgatggagattatttgccagatgctgtg
ctctggcgccagaaggaacagttctcggatggcgtgggctacgccctcatcgacgccctg
ccagagtttgcggctcgtcatgtgaccgatgcacagctccaagcggcagagcaacgtttt
tccatcaatccgcccaagaccaaggaggcctactactatcgctgcatcttcgaggaacag
ttccctggcaaggcagctgccaacactgtggcgaagtggacgccacgccaggactggggt
tgtccagaagatccgtcagggcgggcacaggcggcccataatcaggcctatggcaagtgt
taa

DBGET integrated database retrieval system