KEGG   Drosophila mojavensis: Dmoj_GI13124Help
Entry
Dmoj_GI13124      CDS       T01062                                 

Definition
GI13124 gene product from transcript GI13124-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dmo  Drosophila mojavensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dmoj_GI13124
Enzymes [BR:dmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dmoj_GI13124
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C44
   Dmoj_GI13124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 560 aa AA seqDB search
MCGILAIFSANGEAIGATNFQGSEHSLRELAYRQSGKQRHRGPDDTGVLVIEEQGVALVH
ERLAVIGVETGHQPLVSQDGNVALIANGEIYNYVELAEQIGKRLPGYRPRSDCNVIIELY
EEHGQELLQHITGMFSFVLYDRRRRQLLVARDPYGIIPLYMGQDAQDNLWFSSEMKCLMG
VCERLQIFPPGHLAAGTVLQIQPVRYHNPSWRQLTPTRPVNLQELRHQLELAVRSHLQCD
VPFGALLSGGVDSSLIASIAAKIMRERDANYKLRTFSVGMPGSPDFEHARLVAQHIGSQH
TEISFTVEDCLDGLRDLIYHLESYDIATVRCSLPMFYLARHVKSTGIKMILSGEGADEIF
GGYLYFHKAPNYDQFHEEMVTICERLHVSDILRANKVTMSKGLELRVPFLDTQLVNHVMS
IRPQDKIPGALNEFAGERKWRMEKFVLREAFDGDYLPDAVLWRQKEQFSDGVGYALIDAL
PEFAARHVTDAQLQAAEQRFSINPPKTKEAYYYRCIFEEQFPGKAAANTVAKWTPRQDWG
CPEDPSGRAQAAHNQAYGKC
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcttagccatattctcggcgaacggagaagcgattggagcaacaaatttt
cagggcagcgagcacagtttgcgggagttggcctatcggcagagtgggaagcaacggcat
cgtggacccgatgacacgggcgtcctggttatagaggagcagggcgtggctttggtgcat
gaacggctggcggtcattggcgtggagacgggccatcagccgctggtgtcgcaggacggc
aacgttgccctgattgccaacggcgagatctacaactatgtggagctggccgagcagatt
ggcaagcgcttgcccggctatcggcccaggagcgattgcaatgtgatcatcgagctgtac
gaggagcacggccaggagttgctccagcacatcacaggcatgttcagctttgtgctctac
gatcgtcgcagacgtcagctgctggtggcccgcgatccctatggcattattcctctctac
atgggccaggatgcgcaggacaacttgtggttttcctcggaaatgaagtgcctgatgggc
gtgtgcgagcgattgcagatcttcccacctggccatctggcagcgggcacagtgctgcag
atccagcccgtgcgctaccacaatcccagctggcgccagttgacgcccacgcggccggtg
aatcttcaagagctgcgtcaccaactggagctggctgtgcgctcgcatttgcagtgtgac
gtgccctttggagcgctgctctcgggtggcgtggactccagcctgatagcttcgatagct
gcgaagatcatgagggaacgggacgctaactacaagctgcgcaccttctcggtgggcatg
cccggttcaccagacttcgagcatgcacgcctggtggcccagcacattggcagccagcac
acggagatcagcttcaccgtggaggactgcctggatgggctgcgcgatctgatctatcac
ctggaatcatacgatatagccactgtgcgctgcagcctgcccatgttctacctggcccgc
catgtgaagagcaccggcatcaagatgatcctctcgggcgagggcgcggacgagatcttt
ggcgggtatctctacttccacaaggcgcccaactacgatcagttccacgaggagatggtc
acgatctgcgagcggctgcatgtctccgatatattgcgtgccaacaaggtgaccatgtcc
aagggactggagctgcgtgtgcccttcctggatacccagctggtaaaccatgtgatgagc
atacgtccgcaggacaagattccaggtgctcttaatgagtttgcgggggaacgaaagtgg
cgcatggagaagtttgtgctgcgcgaagccttcgatggagattatttgccagatgctgtg
ctctggcgccagaaggaacagttctcggatggcgtgggctacgccctcatcgacgccctg
ccagagtttgcggctcgtcatgtgaccgatgcacagctccaagcggcagagcaacgtttt
tccatcaatccgcccaagaccaaggaggcctactactatcgctgcatcttcgaggaacag
ttccctggcaaggcagctgccaacactgtggcgaagtggacgccacgccaggactggggt
tgtccagaagatccgtcagggcgggcacaggcggcccataatcaggcctatggcaagtgt
taa

DBGET integrated database retrieval system