KEGG   Drosophila mojavensis: Dmoj_GI13141Help
Entry
Dmoj_GI13141      CDS       T01062                                 

Definition
GI13141 gene product from transcript GI13141-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI13141
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmoj_GI13141
Translation factors [BR:dmo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmoj_GI13141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 238 aa AA seqDB search
MASAQMQPFEPSVFEPNKFLQSRLEQSILNEKQELLKERDHELENMPGEQSEQTYKIEYK
HPLEHVWTLWYLENDRTKHWKDMLNEITQIDSIETFWGLYYTIKTPSELKIGSDYYMFKH
GIQPMWEDEANIKGGRWLFTVGKSSKYALDRIWLDILLMMVGESFEYASEICGAVVNIRA
KSNKISVWTANGTNELAVLEIGFKLKTLLHLQSHNLQYQLHSDAMSKINSGVRSVYSL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgcccaaatgcaaccgtttgaaccatcggtctttgagccaaataaatttctg
cagagtcgcttggaacaatcgatccttaacgagaaacaggagctgctaaaggaaagagac
catgagctggaaaatatgcccggggagcagagtgaacagacgtataaaatcgaatacaaa
catccgctagagcatgtctggacactatggtacctagagaacgatcgcaccaaacactgg
aaggacatgctcaatgaaatcactcaaatagatagcattgaaacattttggggattatac
tatactatcaaaacaccatcagagcttaagattggcagcgattattatatgtttaaacat
ggcattcaaccaatgtgggaggatgaagctaacataaagggcggacgctggctcttcact
gtcggcaagagttcgaagtatgccctggatcgcatctggttggatatactgttaatgatg
gtgggcgagtcttttgaatatgctagtgaaatttgtggtgctgtagttaacatacgtgcg
aaaagcaataagatatctgtttggacggccaatggaaccaacgagctggccgttctagag
attggttttaagttgaaaaccttattacacctacaatcgcacaacttgcaataccagctg
cactcggatgcgatgtcaaaaataaattctggagtcagatctgtatatagtctataa

DBGET integrated database retrieval system