KEGG   Drosophila mojavensis: Dmoj_GI13148Help
Entry
Dmoj_GI13148      CDS       T01062                                 

Definition
GI13148 gene product from transcript GI13148-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI13148
   04068 FoxO signaling pathway
    Dmoj_GI13148
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmoj_GI13148
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dmoj_GI13148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 556 aa AA seqDB search
MAAISGPKRHPLSSQHHFSHPTTTTTTTATATNCSSSTTTTTTTNTSSNGNINSTNNNSK
QRLYIYQTPANPQHTAQSYSTTTNTTTTNIATAIATVAAVATTTKKSNSSSINSCPNSSA
AAPRSSMSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVV
WAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFF
QEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLV
NSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFG
ELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTL
SSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY
TADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASS
TVAHPSELPPSPHQWE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcggccattagtggccccaagcggcatccattgagcagtcaacaccatttctcccat
ccaactaccaccaccaccaccaccgccaccgccacgaactgcagcagcagcaccaccacc
accacaaccaccaacaccagcagcaacggcaacatcaacagcactaacaacaacagcaag
caacgactttatatctatcaaacgccagctaatccccagcacacagcacaaagttactcc
accactaccaacaccaccaccaccaacatcgccactgccatcgccaccgtagccgccgtc
gccaccaccactaagaagagcaacagcagcagcatcaacagctgcccaaattcttcagct
gctgcgccgcgtagctcgatgagcgtttcgatgtcactggtacagggtggtgctgccggt
ggtgcgccacagggcgccagcgcaatattggccgcagcggctccatattatcagccgcca
gcggtgccacaggatgtccagccggatcgtccaattggctacggtgcattcggagttgtc
tgggccgtcacagatccacgcgatggccgtcgcgtcgcactgaaaaagctgccgaatgtg
ttccaatctctggtctcatccaagcgtgtttttcgtgagctcaaaatgctttgctttttc
aagcatgaaaacgtgctgtcagctttggacattttacagccaccacatttggacttcttt
caggaaatctatgtgataactgaactgctgcaatcggatctgcacaagatcatcgtgtcg
ccgcagcatctgtcggcggaccacatcaaggtctttctctatcagatactgcgtggcctg
aagtatttgcactcggccaggatactgcatcgggacatcaagccgggcaatctgttggtc
aactccaattgtgtgctgaagatatgcgactttgggctggcacgcgtcgaggagcccgac
caggccaagcacatgacccaggaggtggtcacacaatactatcgggcacccgaaatactc
atgggcgctcgccactattcgtcggctgtggatgtgtggtcggtgggctgcatctttggt
gagctgctgggccggcgcatattgttccaggcgcagaatccggtgcagcagctggagctc
atcaccgagctgctgggcacgcccaccatggaggatatgcgtcatgcgtgcgagggcgca
cgcacacacatgctgcggcgggcgcccaagccgccatcgttctcggtgctctacacgctc
agctcacatgccacgcacgaggcggtgcatctgctctgccagatgcttgtctttgatccg
gacaagcgcatttcggtgacagatgctctggcgcatccgtatctggatgagggccgtctg
cgctatcattcgtgcatgtgcaaatgctgtttcactacctcagccggaatgcgtcagtat
acggcggactttgagccctccgccgggcagcccttcgatgatttatgggagcgcaagctc
acctcagtgcagcaggtgaaggaggagatgcacaaattcattgccgagcaactgcaaacg
ggccgtgtgccgctctgcattaatccgcagagtgcggccttcaagagctttgccagctcc
actgtggcacatccttcggagctgccgccttcgccacatcaatgggaatga

DBGET integrated database retrieval system