KEGG   Drosophila mojavensis: Dmoj_GI13148Help
Entry
Dmoj_GI13148      CDS       T01062                                 

Definition
GI13148 gene product from transcript GI13148-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dmo04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 556 aa AA seqDB search
MAAISGPKRHPLSSQHHFSHPTTTTTTTATATNCSSSTTTTTTTNTSSNGNINSTNNNSK
QRLYIYQTPANPQHTAQSYSTTTNTTTTNIATAIATVAAVATTTKKSNSSSINSCPNSSA
AAPRSSMSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVV
WAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFF
QEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLV
NSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFG
ELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTL
SSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY
TADFEPSAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASS
TVAHPSELPPSPHQWE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcggccattagtggccccaagcggcatccattgagcagtcaacaccatttctcccat
ccaactaccaccaccaccaccaccgccaccgccacgaactgcagcagcagcaccaccacc
accacaaccaccaacaccagcagcaacggcaacatcaacagcactaacaacaacagcaag
caacgactttatatctatcaaacgccagctaatccccagcacacagcacaaagttactcc
accactaccaacaccaccaccaccaacatcgccactgccatcgccaccgtagccgccgtc
gccaccaccactaagaagagcaacagcagcagcatcaacagctgcccaaattcttcagct
gctgcgccgcgtagctcgatgagcgtttcgatgtcactggtacagggtggtgctgccggt
ggtgcgccacagggcgccagcgcaatattggccgcagcggctccatattatcagccgcca
gcggtgccacaggatgtccagccggatcgtccaattggctacggtgcattcggagttgtc
tgggccgtcacagatccacgcgatggccgtcgcgtcgcactgaaaaagctgccgaatgtg
ttccaatctctggtctcatccaagcgtgtttttcgtgagctcaaaatgctttgctttttc
aagcatgaaaacgtgctgtcagctttggacattttacagccaccacatttggacttcttt
caggaaatctatgtgataactgaactgctgcaatcggatctgcacaagatcatcgtgtcg
ccgcagcatctgtcggcggaccacatcaaggtctttctctatcagatactgcgtggcctg
aagtatttgcactcggccaggatactgcatcgggacatcaagccgggcaatctgttggtc
aactccaattgtgtgctgaagatatgcgactttgggctggcacgcgtcgaggagcccgac
caggccaagcacatgacccaggaggtggtcacacaatactatcgggcacccgaaatactc
atgggcgctcgccactattcgtcggctgtggatgtgtggtcggtgggctgcatctttggt
gagctgctgggccggcgcatattgttccaggcgcagaatccggtgcagcagctggagctc
atcaccgagctgctgggcacgcccaccatggaggatatgcgtcatgcgtgcgagggcgca
cgcacacacatgctgcggcgggcgcccaagccgccatcgttctcggtgctctacacgctc
agctcacatgccacgcacgaggcggtgcatctgctctgccagatgcttgtctttgatccg
gacaagcgcatttcggtgacagatgctctggcgcatccgtatctggatgagggccgtctg
cgctatcattcgtgcatgtgcaaatgctgtttcactacctcagccggaatgcgtcagtat
acggcggactttgagccctccgccgggcagcccttcgatgatttatgggagcgcaagctc
acctcagtgcagcaggtgaaggaggagatgcacaaattcattgccgagcaactgcaaacg
ggccgtgtgccgctctgcattaatccgcagagtgcggccttcaagagctttgccagctcc
actgtggcacatccttcggagctgccgccttcgccacatcaatgggaatga

DBGET integrated database retrieval system