KEGG   Drosophila mojavensis: Dmoj_GI13203Help
Entry
Dmoj_GI13203      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00040  Pentose and glucuronate interconversions
dmo00052  Galactose metabolism
dmo00500  Starch and sucrose metabolism
dmo00520  Amino sugar and nucleotide sugar metabolism
dmo01100  Metabolic pathways
Module
dmo_M00361  Nucleotide sugar biosynthesis, eukaryotes
dmo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmoj_GI13203
   00052 Galactose metabolism
    Dmoj_GI13203
   00500 Starch and sucrose metabolism
    Dmoj_GI13203
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI13203
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dmoj_GI13203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6582209
NCBI-ProteinID: XP_002007913
FlyBase: FBgn0135960
UniProt: B4KVE6
Position
Unknown
AA seq 520 aa AA seqDB search
MTSGIRPIDVLLQRAGIRGHQRAPSDSKEFHEVTKRDALRLLENEVDRLLQTTEPARRPA
LQAEMGRFADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKAPKNEQNEIRSMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKKFIDEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPFEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLN
MEIIVNNKTLENGLRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaggcatacgacccattgatgtgctactgcagcgagccggtatacgcggccac
cagcgcgctccatccgattcgaaggagttccacgaggtaaccaagcgcgatgcactgcgt
ctgctcgagaatgaagtggatcgtctgctccagacgacagaaccggctcgtcgtccagca
ctgcaagcggaaatgggtcggtttgccgatctcttcgggcgtttccttcaagaggaggga
cctgcgctggactggaacaaaattcagaagttgcccgaaaatgcagtcatgaactattct
aatctcaaggcgcccaagaacgagcagaatgagatccggagcatgttggacaaactggtg
gtcattaagctgaatggtggtctgggcacctccatgggctgccacggaccaaagagtgtc
attcccgtgcgttctgatttgaccttcctggatctgacggtacagcaaattgagcatctc
aataagacatacgatgccaatgtgccgctcgtgctgatgaactccttcaatacggacgag
gatacggagaagattgtgcgcaaatataagggattccgtgtgcagatacacaccttcaat
cagagctgctttccgcgtatcagccgcgagcatttcctgcccgtcgccaaggactttgat
gtggagaaggacatggaggcctggtacccacctggtcacggcgacttctacgataccttc
cgtaactcgggtctgctgaagaaattcattgacgagggccgtgagtactgcttcctctcc
aatattgacaatctgggcgccaccgtcgacctgaacatactcaacaagctggtgggcgag
gagcgcgccagcacgcccttcgaattcgtcatggaggtgaccgacaagacccgtgctgat
gtcaagggtggcacgctcatccaaatggagaacaagctgcgactgctggaaattgctcag
gtgcccaaggagcacgtcgatgacttcaagtccgtcaagaccttcaagttcttcaacacc
aacaacatttgggccaatctggctgcgattgaccgagtgctgcgcgagcgcacgctcaac
atggagatcattgtaaacaacaagacactcgagaatggactgcgcgtcattcagctggag
acggcggtgggtgcggccatgaagtgcttcgatggcgccattggcatcaatgtgccacgc
tctcggttcttgcccgtgaagaagtcgtcggatctgctgctcgtcatgtcgaatttgtat
acgcttaagaatggcagcctagtgatgtcgccgcagcgcatgttccccaccacgcccctg
gtcaaactgggcgaaaatcacttctcgaaggtcaaagagttcttgggtcgctttgccaac
atacccgacatcattgagctagaccacttgacagtcagcggggatgtgaccttcggccgt
ggcgtgtccttgcgcggcactgtgatcattattgccaatcatggcgatcgtatcgacata
cccgccggtgccatcttggagaacaaaatcgtgtctggcaacatgcgcatcttggatcat
taa

DBGET integrated database retrieval system