KEGG   Drosophila mojavensis: Dmoj_GI13203Help
Entry
Dmoj_GI13203      CDS       T01062                                 

Definition
GI13203 gene product from transcript GI13203-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dmo  Drosophila mojavensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dmo00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dmo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dmo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dmo00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 520 aa AA seqDB search
MTSGIRPIDVLLQRAGIRGHQRAPSDSKEFHEVTKRDALRLLENEVDRLLQTTEPARRPA
LQAEMGRFADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKAPKNEQNEIRSMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKKFIDEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPFEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLN
MEIIVNNKTLENGLRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaggcatacgacccattgatgtgctactgcagcgagccggtatacgcggccac
cagcgcgctccatccgattcgaaggagttccacgaggtaaccaagcgcgatgcactgcgt
ctgctcgagaatgaagtggatcgtctgctccagacgacagaaccggctcgtcgtccagca
ctgcaagcggaaatgggtcggtttgccgatctcttcgggcgtttccttcaagaggaggga
cctgcgctggactggaacaaaattcagaagttgcccgaaaatgcagtcatgaactattct
aatctcaaggcgcccaagaacgagcagaatgagatccggagcatgttggacaaactggtg
gtcattaagctgaatggtggtctgggcacctccatgggctgccacggaccaaagagtgtc
attcccgtgcgttctgatttgaccttcctggatctgacggtacagcaaattgagcatctc
aataagacatacgatgccaatgtgccgctcgtgctgatgaactccttcaatacggacgag
gatacggagaagattgtgcgcaaatataagggattccgtgtgcagatacacaccttcaat
cagagctgctttccgcgtatcagccgcgagcatttcctgcccgtcgccaaggactttgat
gtggagaaggacatggaggcctggtacccacctggtcacggcgacttctacgataccttc
cgtaactcgggtctgctgaagaaattcattgacgagggccgtgagtactgcttcctctcc
aatattgacaatctgggcgccaccgtcgacctgaacatactcaacaagctggtgggcgag
gagcgcgccagcacgcccttcgaattcgtcatggaggtgaccgacaagacccgtgctgat
gtcaagggtggcacgctcatccaaatggagaacaagctgcgactgctggaaattgctcag
gtgcccaaggagcacgtcgatgacttcaagtccgtcaagaccttcaagttcttcaacacc
aacaacatttgggccaatctggctgcgattgaccgagtgctgcgcgagcgcacgctcaac
atggagatcattgtaaacaacaagacactcgagaatggactgcgcgtcattcagctggag
acggcggtgggtgcggccatgaagtgcttcgatggcgccattggcatcaatgtgccacgc
tctcggttcttgcccgtgaagaagtcgtcggatctgctgctcgtcatgtcgaatttgtat
acgcttaagaatggcagcctagtgatgtcgccgcagcgcatgttccccaccacgcccctg
gtcaaactgggcgaaaatcacttctcgaaggtcaaagagttcttgggtcgctttgccaac
atacccgacatcattgagctagaccacttgacagtcagcggggatgtgaccttcggccgt
ggcgtgtccttgcgcggcactgtgatcattattgccaatcatggcgatcgtatcgacata
cccgccggtgccatcttggagaacaaaatcgtgtctggcaacatgcgcatcttggatcat
taa

DBGET integrated database retrieval system