KEGG   Drosophila mojavensis: Dmoj_GI13353Help
Entry
Dmoj_GI13353      CDS       T01062                                 

Definition
GI13353 gene product from transcript GI13353-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dmo  Drosophila mojavensis
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmoj_GI13353
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dmoj_GI13353
Ubiquitin system [BR:dmo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dmoj_GI13353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 925 aa AA seqDB search
MMIQEPVQAAIWHCLNHYDNRDAVFLAERLCSEVESDETIYLLATSYYRSNQLDQAYWLL
QEKSRRSPQCRYLQAKCAYELKKYAEAESALVSSGFADSKHFDELQREFGDIACFAYQLV
AQICMRTERQKLAVNALRRALKLNPFMWHAFADLCLLGQDTDTAAIFQIQSTDVFNTCQG
SSANANSMVLFSGSSANEQQQQLENILLNNISNNSHYILNTPVDHNQQQQQQQQQNNNGS
SLATLQNLMTPNNNINNNNNNNLNSSITMLRGGGGGGVQQQQNTNSSMMLLEDTPMGYAT
HDAPTQLHQQHPQQLYDANSGTPFRKQFKYLSAISPLTPSFGVMPLTSPSDGGSAVLQAN
LSVSAYSPLPQMLVEVNQEPKMMGKKFKAHVGGLINRQDKSKPAVFTQAGNITPRTPNNV
VGNGPPNPNAAVRRSSRLFSNSAYSVKENNKSPNITNNNKFVQPRSPPRKTKSSRMTKIC
LSNELIDEKSHHHLAEKLSEKQSRKEKEKVETITSAATAGGNNQTGVNNRSADDAKVLLN
NSLNNAQTLAHQLLTMKKQSADGLMLLLRDLAEGYKLLSSFQCKAAIMHLEATIPKHHLN
SSWVQSLIGLCRYELREYEAAVVIFKRIHEMEPRRLEYMEIYSTSLWHLQKEVALSALAQ
DLIAQDKRSPVTWCVAGNCFSLHKEHETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEF
DKAMDYFRAAVVRDPRHYNAWFGIGTIYSKQEKYELAELHYLKALKINTQNSVILVHIGA
MQFFMQKKDLALQTLNTAATIDPKNPLARFHRGSIYFSLGKYQEALRELEELKEIVPKES
VVFYLIGKIHKTLGNMDLALMHFSWATDLDPKGANNQIKDAFDSMAHPNCCPANDNALDV
DFEPTSERSDDSTQAQQDVSYDSDY
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgatgatacaagagcctgtacaggccgccatatggcactgtctgaaccactacgataat
agggatgcagttttcctggcggaacgcctctgctcagaagtggaaagtgatgagacaata
tatttgttagccaccagctattatcgttcaaatcaattggatcaagcttattggctgcta
caagagaagtcgcgacgctccccccaatgccgctacttgcaggccaaatgcgcctacgag
ctgaaaaagtacgcagaggcggaaagtgctctggtttcgagtggatttgcggatagcaaa
catttcgatgagctgcagcgtgagtttggggatattgcctgtttcgcttatcaattggtg
gcgcagatttgtatgcgcacagagcgccagaagctggcagtgaatgcactacgacgagcg
ctcaaactgaaccctttcatgtggcatgcgtttgccgatctgtgcctgctgggtcaggac
acggataccgcggcaatattccaaattcaaagcactgatgtgttcaacacttgccaaggc
agcagcgccaacgccaattcgatggtgctgttcagcggcagctctgctaacgagcagcaa
cagcagctagaaaatattttgctaaacaatataagcaataattcacattatatactaaat
accccagtggaccacaatcagcagcagcagcagcaacagcagcagaacaacaacggcagc
agcttggccaccctacagaatctgatgacaccaaacaacaacattaacaacaacaacaat
aacaatctcaacagctctattaccatgctgcgaggtggtggcggcggtggcgttcaacag
cagcagaacaccaattcaagtatgatgctgctcgaggacacgcctatgggttatgcaacg
catgatgctcccacacaactgcatcaacagcacccgcagcaattgtatgatgccaacagc
ggcacaccgtttcggaagcaattcaaatatttgtctgcaatatcaccgttaactcccagc
tttggcgttatgccgctgactagtccctccgatggcggctcagctgtattgcaagcaaat
ttgagtgtgtctgcgtattcgccattgccccaaatgcttgtggaggttaatcaagagcca
aaaatgatgggaaagaaatttaaggcgcatgttggtggcctcatcaatcgtcaggacaag
agtaaacccgccgtttttacgcaggctggcaatataacgcctcgtacaccaaacaatgtg
gtgggcaatggtccacccaatcctaatgcggcggtgcgtcgcagctcgcggttattcagc
aattcggcatactcggtcaaggagaacaacaaatcgcccaacatcacgaataacaataaa
tttgttcagccgcgatcgccgccacgtaaaaccaaatcgtcacgcatgacgaaaatctgt
ttaagcaacgagctcattgatgagaagtcgcatcaccatctcgccgagaagctgagcgaa
aagcaatcacgcaaggagaaagaaaaagtggaaacaatcacatcggctgcgacagccggc
ggcaacaatcaaacaggagtaaacaatcgcagcgccgacgacgccaaagtcctgctaaac
aatagcctgaataatgcccaaacactggcgcatcagctgctaaccatgaaaaagcaatcg
gcagacggtctaatgctgcttctccgggaccttgccgagggctacaaactactgtcatcg
tttcaatgcaaggcggctattatgcatctggaggcaactataccaaagcatcatctgaac
tcgagttgggtgcaatcgctgattggcttgtgtcgctatgagctgcgtgaatacgaagct
gctgtggtcatattcaagcggatacacgaaatggagccacgtcgcctggagtacatggaa
atctattccacatccctatggcacttgcaaaaggaggtggcgttgtcggccctggcgcag
gacctgattgcacaggataagcgcagtccggttacgtggtgtgtggctggcaattgtttt
tcactgcacaaggagcatgagacggccatcaaattctttaagcgtgcggtgcaagtggat
cccgacttcgtttacagttacacgctcctgggccacgaactggtacttaccgaggaattt
gacaaggccatggactattttagagcagcagttgtacgcgatccgcggcattataatgcc
tggtttggcataggcaccatctactccaagcaggagaaatacgaactggccgagctgcac
tatctcaaggcactcaagatcaatacgcagaactcggtcattctggtgcacattggagcg
atgcagttctttatgcagaagaaggatttggcactgcagacgctgaatacggcagctacg
atagatccgaaaaatcctttggcccgattccatcgcggctcaatatatttctcattgggc
aaatatcaagaggcattgcgtgagctggaggagctgaaggaaattgtgccaaaggagtca
gttgtattttatctaattggtaaaatacacaagacgctgggcaacatggatttggcactg
atgcatttcagctgggccaccgatctggatcccaagggggccaacaatcaaatcaaagat
gccttcgattcaatggcgcatcccaattgctgcccagctaatgacaatgctcttgatgtt
gactttgaaccaacatcggagcgttccgacgactcaacgcaggcgcagcaggatgttagc
tacgacagcgactactaa

DBGET integrated database retrieval system