KEGG   Drosophila mojavensis: Dmoj_GI13386Help
Entry
Dmoj_GI13386      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6 Lipase_3 Spo7_2_N
Motif
Other DBs
NCBI-GeneID: 6582549
NCBI-ProteinID: XP_002008250
FlyBase: FBgn0136143
UniProt: B4KY24
Position
Unknown
AA seq 367 aa AA seqDB search
MEPAEQSNNITLSWWPSVSEKLLDILTMKMNIFTSFPLELAATVIDSLCSSTLFMGGVPA
QIQPDITKMHFQYMTPCLNYSVPLLKADKLWNHPQFRRNRKLVILATGWTNTVNASATIA
MISRAFMCRPRVNFVIVDAAYYVDTLYKWSALNTDLIGEHIAVGLQHLIKVSPLIDIHLI
GHSLGAHIMGTAGRTFKQLTGYRVSRITALDPAKPCFRNEKSLPGLMRGDAELVDVIHTN
NGILAKRDPIGDIDFYPGGVHPIKPGCLTIGCSHTRAVEYFAESVYPQQERSFVGTRCSS
WKMLEWHRCKSDITSTMGYLINRKANGIFYVDVNARSPFGKNYNLPRKGIADCAKTSCIS
KLLSKLQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgctgaacagtcgaataacataacgttaagctggtggccgagtgtctctgaa
aaactcctggatatcctaaccatgaaaatgaatatattcacatcgtttccgttggagttg
gctgccactgttattgacagcttgtgctcctccactttgtttatgggaggcgtaccagca
caaattcagccggatataacgaaaatgcactttcagtacatgacaccgtgtctgaactat
agtgttcctttgctgaaagctgacaagctttggaatcatccgcaatttcgtcgcaatcgt
aaattggttatattagctacgggctggacaaatacggttaacgcttcagctaccattgcg
atgatatcgagggcttttatgtgcagacctcgcgtgaattttgtgattgtagatgcggct
tactatgtggacaccttgtacaagtggtcagccttgaatactgatctcattggcgagcat
atagctgttggcttacagcatttgattaaagtctccccgttgattgatattcatttgata
ggtcattcattgggcgcacacatcatgggcaccgctgggcggacattcaaacaactgacg
ggatatcgtgtgtctcgtattacagctctggatcctgccaagccatgctttcgcaatgaa
aagtcgctgcccggtctaatgcgaggcgatgctgaattagtagatgtgatacatacaaat
aatggtattctggctaaacgagatccaatcggtgacatagacttctatcccggtggtgtt
catcccataaagcctggctgtctgaccatcggctgctctcacacgcgagcagttgagtat
tttgcagagagtgtctatccgcaacaggagcgcagctttgtgggtactcgatgcagctcc
tggaagatgcttgaatggcacaggtgcaaatctgacataacttcaaccatgggttacttg
ataaacagaaaggccaatggcattttctacgtggatgtgaatgctcgaagtccctttggg
aagaactacaatctaccaaggaaaggtatcgctgactgcgctaaaaccagttgcatttct
aaattactgagtaaattgcaatag

DBGET integrated database retrieval system