KEGG   Drosophila mojavensis: Dmoj_GI13386Help
Entry
Dmoj_GI13386      CDS       T01062                                 

Definition
GI13386 gene product from transcript GI13386-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmoj_GI13386
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dmoj_GI13386
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dmoj_GI13386
  Exosomal proteins of breast milk
   Dmoj_GI13386
Heparan sulfate/heparin binding proteins [BR:dmo00536]
 Enzymes (General comment) Variety
  Dmoj_GI13386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 367 aa AA seqDB search
MEPAEQSNNITLSWWPSVSEKLLDILTMKMNIFTSFPLELAATVIDSLCSSTLFMGGVPA
QIQPDITKMHFQYMTPCLNYSVPLLKADKLWNHPQFRRNRKLVILATGWTNTVNASATIA
MISRAFMCRPRVNFVIVDAAYYVDTLYKWSALNTDLIGEHIAVGLQHLIKVSPLIDIHLI
GHSLGAHIMGTAGRTFKQLTGYRVSRITALDPAKPCFRNEKSLPGLMRGDAELVDVIHTN
NGILAKRDPIGDIDFYPGGVHPIKPGCLTIGCSHTRAVEYFAESVYPQQERSFVGTRCSS
WKMLEWHRCKSDITSTMGYLINRKANGIFYVDVNARSPFGKNYNLPRKGIADCAKTSCIS
KLLSKLQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgctgaacagtcgaataacataacgttaagctggtggccgagtgtctctgaa
aaactcctggatatcctaaccatgaaaatgaatatattcacatcgtttccgttggagttg
gctgccactgttattgacagcttgtgctcctccactttgtttatgggaggcgtaccagca
caaattcagccggatataacgaaaatgcactttcagtacatgacaccgtgtctgaactat
agtgttcctttgctgaaagctgacaagctttggaatcatccgcaatttcgtcgcaatcgt
aaattggttatattagctacgggctggacaaatacggttaacgcttcagctaccattgcg
atgatatcgagggcttttatgtgcagacctcgcgtgaattttgtgattgtagatgcggct
tactatgtggacaccttgtacaagtggtcagccttgaatactgatctcattggcgagcat
atagctgttggcttacagcatttgattaaagtctccccgttgattgatattcatttgata
ggtcattcattgggcgcacacatcatgggcaccgctgggcggacattcaaacaactgacg
ggatatcgtgtgtctcgtattacagctctggatcctgccaagccatgctttcgcaatgaa
aagtcgctgcccggtctaatgcgaggcgatgctgaattagtagatgtgatacatacaaat
aatggtattctggctaaacgagatccaatcggtgacatagacttctatcccggtggtgtt
catcccataaagcctggctgtctgaccatcggctgctctcacacgcgagcagttgagtat
tttgcagagagtgtctatccgcaacaggagcgcagctttgtgggtactcgatgcagctcc
tggaagatgcttgaatggcacaggtgcaaatctgacataacttcaaccatgggttacttg
ataaacagaaaggccaatggcattttctacgtggatgtgaatgctcgaagtccctttggg
aagaactacaatctaccaaggaaaggtatcgctgactgcgctaaaaccagttgcatttct
aaattactgagtaaattgcaatag

DBGET integrated database retrieval system