KEGG   Drosophila mojavensis: Dmoj_GI13568Help
Entry
Dmoj_GI13568      CDS       T01062                                 

Definition
GI13568 gene product from transcript GI13568-RA
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dmo  Drosophila mojavensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dmo00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 773 aa AA seqDB search
MLRNSCKALRNSFSSNTWRAASTHGPRQPLPSIEKRLEKAHPQFTERSQLKYARRLVVKL
GSAVITREDNHGLALGRLASIVEQVAECHLEGREVIMVTSGAVAFGKQKLAQELLMSLSM
RETLNPKDTKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYNEET
RNNLFSTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARKGIPIKDNDSLSAMLAAE
VQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDINSIEFGKKSKVGTGGMDSKVKAAT
WALDRGVSVVICNGMQEKAIKTIVGGRKVGTFFTEATESANTIPVEVMAENARTGSRQMQ
ALSPAERALAVNNLADLLVSREKFILEANAKDLEEAQKSGLAKPLLSRLSLNSAKLKNLS
IGLRQIADDSHKNVGRVLRRTRLADGLELKQVTVPIGVLLVIFESRPDSLPQVAALAMAS
ANGLLLKGGKEAAHSNKALMELVKEALGSVGAEHAVSLVSTREEISDLLAMENHIDLIIP
RGSSELVRNIQEQSLHIPVLGHAEGVCHVYVDKDADLSKALHIARDAKCDYPAACNAMET
LLIHEDLMSGQIFNDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLRHEYGALECCIEI
VPSLEEAINHIHTYGSGHTDVIVTENDATAQRFLNTVDSACVFHNASSRFADGFRFGLGA
EVGISTARIHARGPVGVEGLLTTKWILNGQDHAAADFVEGGTRTWLHQQLPID
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaatagctgcaaggcactgcgcaacagcttttcaagcaacacctggagagcg
gccagcacccacggacccaggcagccactgccgtccatagagaagcgcctggagaaagcc
catccacagttcacggaacgaagccagctcaaatatgcccgtcgcctggtcgttaaactg
ggcagtgctgtcatcacgcgcgaggataatcatggcctggctctgggtcgtctggcttcc
attgtggagcaggtcgccgagtgccatttggagggtcgagaggtcatcatggtgaccagc
ggagctgtggcctttggcaagcagaaactggcccaggagctgctcatgtcgctgtcgatg
cgtgagacgttgaatccaaaggacaccaaagagttcgatggcgccacactggagccacgt
gcagctgctgcggtgggtcagtcgggtcttatgtcactctacgatgcgatgtttgcccag
tacggcgtcaagattgcacaggtgctagttaccaagccggacttctacaacgaggaaaca
cgcaacaatctcttctccacgctctccgaattaattagcctaaatatcgtgccaatcatc
aacacgaacgatgccgtctctccgccgatgtttatacgtgacgacgagccggctggcggt
gccagaaagggcatacccattaaggacaacgacagcttgtcggccatgctagccgctgag
gtgcaggctgatctgctaatcctcatgtctgacgtcgatggcatttataataagccaccc
tgggaggatggcgccaagctgatgcacacctacaccagcgacgacatcaacagcattgag
tttggcaagaagtccaaggtgggcaccggcggcatggactcgaaggtgaaggcagctact
tgggctctagaccgcggcgtcagcgttgttatatgcaacggcatgcaggagaaggccatc
aagacaattgtgggcggcagaaaagttggcacattcttcaccgaagccaccgagagcgcc
aacaccatacccgtcgaggtgatggccgagaacgctcgaactggcagtcgtcagatgcag
gcgctgtccccggccgagcgcgcgttggccgtcaacaatttggctgatctgctggtgagc
cgcgagaagttcatattggaggcgaatgccaaggacctggaggaggcccagaagagcggc
ctggcgaagccgctgctgtcgcgcctatcactcaactcggccaagttgaagaacctgtcg
attggcctcaggcaaatcgccgatgacagtcacaagaatgtgggtcgcgtgctgcgccgc
acccgcctggccgacggactcgagctgaagcaggtgactgtgcccattggcgtgctgctc
gttatcttcgagtcgcgcccggactcgctgccccaagtggccgccctggccatggcgtcc
gccaacgggctgctgctcaagggcggcaaggaggcggcgcacagcaacaaggcgttgatg
gagctggtcaaggaggcgctcggcagcgtgggcgccgagcatgcagtttccctggtttcc
acacgcgaggaaatcagcgatttgctggctatggagaatcacattgacctgatcatacca
cgcggcagctcggagctggtgcgcaacatccaggagcaatcactgcacatcccagtgctg
ggccatgccgaaggcgtgtgccacgtctacgtggacaaggatgccgacttgagcaaggcc
ttgcacattgctcgcgatgccaagtgcgactatccagcagcctgcaatgcaatggaaacg
ctgctcatacacgaggatctaatgagtggacagattttcaacgatgtctgcaacatgctg
aaacgtgagggcgtcaaaatctatgcgggaccgcgtctgaatcagcaactgacattcggc
ccgcccgctgcgaagagtctgcgccacgaatacggtgccctggagtgctgcattgagatt
gtgcccagtctggaggaagccattaatcacatacatacatacggcagcggtcacacggat
gtcattgttaccgaaaatgatgccacggcacagcgtttcctcaacaccgtggacagcgcc
tgtgtgttccacaatgcgagctcgcgtttcgcggacggcttccgcttcggcctcggcgcc
gaggtgggcatctccacggcccggattcatgcgcgcggcccggtgggcgtcgagggtctg
ctgaccaccaaatggatactcaacggccaggatcatgcggctgctgactttgtcgagggc
ggcacacgcacctggctgcaccagcagctgcccatcgattag

DBGET integrated database retrieval system