KEGG   Drosophila mojavensis: Dmoj_GI13712Help
Entry
Dmoj_GI13712      CDS       T01062                                 

Definition
GI13712 gene product from transcript GI13712-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dmo00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MAAPVIVEATVKQTATLIFMHGLGDTGHGWSSALAAVRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIRAARDDIHGMINKEVSAGIPANRIVLGGFSQGGALALY
SALTYEQPLAGVVALSCWLPLHKQFPDAKVSSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDEEMNDVKDIISKWVK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccggtaattgtggaggccacggtcaagcagacggcgacgcttatattcatg
cacggcttgggcgacactggacatggctggagcagtgctttggctgcagtgcgaccaccc
ttcatgaaggtcatctgtccaacggcaccgacacaacctgtgtcgctgaatgctgggttc
cgtatgccgtcgtggttcgatttgaagaccctggatatcggtgggccagaggatgagccg
ggtatacgcgctgctcgcgatgatattcatggcatgatcaataaggaggttagcgctggc
ataccagccaatcgcatcgtgcttggcggcttctcacaaggcggcgccttggctctctac
tcggcactgacctacgaacagcccttggctggcgtagtggctctgtcatgttggctgcca
ctgcacaagcagtttcccgatgccaaagtgagcagcgacgatgtacccatatttcaggca
catggtgactacgatcccgtggtaccatataaatttggacagctgagcgccagtttgttg
aagtcctttatgaagaatgtcacattcaagacctacagtggactctcgcactcgtcctct
gacgaggagatgaacgacgtgaaggacataatcagtaaatgggtaaaataa

DBGET integrated database retrieval system