KEGG   Drosophila mojavensis: Dmoj_GI13846Help
Entry
Dmoj_GI13846      CDS       T01062                                 

Definition
GI13846 gene product from transcript GI13846-RA
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dmo  Drosophila mojavensis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dmo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 435 aa AA seqDB search
MQLIHAFVSIFLLFLCEANAFYSPSDNVVELTPSNFNREVLQSDAIWVVEFYAPWCGHCQ
SLVPEYKKLAGAVKGVIKVGSVNADEHSELGGKYNVRGFPTIKIFGANKQTPIDYNGQRT
ANAIAEAALAEAKKKVQAAFGGGGGSKSGSSSSGDDVIELTEDNFDKLVLNSDDIWLVEF
FAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKR
ASDAEEYNGGRTASDIISWANDKHTENVPPPELIEITDETTFNTACEGKPLCVVSVLPHI
LDCDANCRNKFLDTLRTLGEKFKQKLWGWAWAEGGQQLALEEALEVGGFGYPAMAVVNFK
KMKFSVLKGSFSKDGINEFLRDISYGRGQTSPVRGAKKPKIVSVDPWDGKNGELPTEEDI
DLSDINLDDEVKDEL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatacatgcatttgttagcatatttttgctatttttatgcgaagcgaatgca
ttttattcaccctccgataacgtcgtggagctaacgccatccaacttcaatcgcgaggtg
ctgcaaagcgatgccatctgggttgttgaattctatgcgccttggtgcggacactgccag
agtctggtgccggaatacaagaaattggctggtgcagtcaagggcgtgattaaagttggc
tctgttaacgccgatgagcattccgaattgggcggcaaatacaacgtacgtggctttccc
acaatcaaaatctttggcgccaacaaacagacgccgatcgattacaatggccagcgcaca
gctaacgcgattgccgaagcagctctcgctgaggccaagaagaaggttcaagcagcattc
gggggcggtggcggaagcaagagtggttcatcgagctccggcgatgacgtcatcgagcta
actgaagataactttgacaaactagttctaaactctgacgatatttggctggtggaattc
tttgcgccctggtgcggtcattgcaagaatctggctccagagtgggccaaggcagcgaag
gagctgaagggcaaagtgaagcttggcgctctggatgccacggcgcatcagagcaaggca
gctgagtacaatgtgcgtggctatccgacaatcaagtttttcccagccggctcgaagcgc
gccagtgacgctgaggagtacaatggcggacgtactgcctccgacataattagttgggcc
aatgacaagcacactgaaaatgtacctccgccagaactgattgagattacggacgagacc
acgtttaacactgcatgcgagggcaagcccttatgcgttgtctctgtgctgcctcatatt
ctggactgcgatgccaactgccgcaacaaattcctggacaccttgcgtacattgggcgag
aagttcaagcagaagctatggggctgggcctgggctgagggtggccaacagttggcactg
gaagaggccttggaagtgggcggctttggctatccggccatggcagttgtgaactttaag
aagatgaagttttcggtactcaagggctccttctccaaagacggcatcaatgaattccta
cgcgacatatcctacggacgtggccaaacgtccccggtgcgcggcgcaaagaaaccaaag
atcgttagcgtcgatccttgggatggcaaaaacggggagctgcccacagaagaagacatc
gatctaagcgatattaacttggatgatgaggtcaaggatgaactgtaa

DBGET integrated database retrieval system