KEGG   Drosophila mojavensis: Dmoj_GI13895Help
Entry
Dmoj_GI13895      CDS       T01062                                 

Definition
GI13895 gene product from transcript GI13895-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dmo  Drosophila mojavensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmoj_GI13895
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dmoj_GI13895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 647 aa AA seqDB search
MNKSQERSTDSAISTPNKADDDLHNVSDTFYTSQRKGSHVFRVRLDATGFTLQRESPSGV
IIKEQKVKICDIIGARCMRMKKSPRNLAGCACVNPGTPAAGSGRKGTPSKCSMASKEENA
TDVGDGSAYLYLFAYVLKKKSLRSSLHRERTVLTLRFRSFDTFEDNMREADRWYRALRWQ
LHQTLEPIFVENIGEPRRRRILVLLNPKSGSGNAREVFNTSVAPILNEAEVPYDLFVTKH
SNYAIEFMSTRRLDEWCTILAVGGDGLFHEVINGLLCRADWAQVMDSLALAIIPCGSGNG
LARSIAHGYNEPYFSNPVLGAALTAISGRTSPMDVVRVEVKNRVMFSFLSIGWGLISDVD
IESECIRMFGYQRFTIWTLYRWANLRTYNGKISYLLADEAEESLETPLLQSEQMRKMQSS
RSCTMHIDKLSNASNHRSMEFLPQEFEDVISLETSINQSFRSRCDSWLSGGSRRSCYYSI
SESIYHSVADDSEFTQPSISAGTKLEQGYPNFGPGTSLPGLDEPLPEAAGWLVEEGEFIM
MHAIYQSHLGIDCHFAPKAQLNDGKIFLVLIRGGISRPHLLSFLYNMSTGSHLPEKNNQY
IKVLQVRAFRLEPYDNHGIITVDGEQIEFGPLQAEILPGISRVMIPK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatctcaggagaggagcactgactccgctatctccacaccgaacaaggcagac
gatgaccttcacaatgtttctgatactttctacaccagccagcgcaagggcagccacgta
tttcgtgtgcgtctggatgccacaggatttactctgcaacgcgaatctcccagtggtgtc
ataatcaaagagcaaaaggtcaaaatatgtgatatcattggagcacgctgcatgcgcatg
aaaaagtcgcctcgaaatctggcaggctgcgcctgcgtcaatccgggcactccagctgcg
ggctccggtcgcaagggcacgcccagcaagtgtagcatggccagcaaggaagagaacgcg
accgacgtgggcgacggcagcgcctatttgtacttgttcgcctacgtgctgaagaagaag
agccttcgcagcagcctgcacagggagcggacagtgctgacgcttcggtttcgatccttt
gatacattcgaggataacatgcgagaggctgatcgctggtatcgtgccttgcgctggcag
ttgcatcaaacgctggagcccatctttgtggagaatataggcgagccgcgtcgtcgccga
atcctggtgctcctcaatcctaagtctggctctggcaatgcacgcgaagtattcaatacg
agtgtcgcaccgattctcaacgaagccgaagtaccttacgatttgtttgtaactaagcat
tccaactatgcaatcgaatttatgagcactcgccgtctggatgagtggtgcaccatttta
gccgttggcggcgacggactgttccacgaggtaatcaacggactgctctgccgcgctgat
tgggctcaagtgatggacagccttgccctggccattattccttgcggctctggcaatggt
ctggcacgctccattgcgcatggctacaatgaaccatacttcagtaatcctgtactaggt
gccgctctgacagccatcagtggtcgcacttcgcccatggacgtggtgcgtgtggaggtt
aagaaccgcgtcatgttttcgttcctgtcgatcggctggggcctcatctcggacgtggac
attgagagtgagtgtatccggatgtttggctaccaacgcttcaccatctggacactctat
cgatgggcaaatttgcgaacctataatggtaagatcagttatttgctagccgatgaggca
gaggagtcgctggaaacgccgctgctgcagtcggaacagatgcgaaaaatgcaatccagc
cgcagctgcacaatgcatatcgataaactgtccaatgccagcaaccaccgttccatggag
tttctgccgcaagagttcgaggatgtcatttcgctggagacttccatcaatcaatcattc
cgctcgcgctgcgacagctggctgtcgggcggctcacgccgcagctgctattattccata
tcagagagtatctatcacagcgtggcggatgacagcgaattcactcaaccgtcgatttcg
gcgggcactaaattggagcagggctatcctaattttggcccaggtacaagcctgccggga
cttgacgaaccattgcccgaggctgcgggctggctggtggaggagggcgaattcattatg
atgcacgccatctaccaatctcatctcggcatcgattgccactttgcacccaaagcccaa
ttgaacgatggcaaaatatttttagttttgattcgcggcggcatcagccgtccacacttg
ctcagctttctctacaacatgagcacgggcagtcacctgcctgagaaaaacaaccagtat
ataaaggtgctgcaggtgcgcgcattccgcttggagccgtacgacaatcacggcatcatc
accgtcgatggcgaacaaatagaatttggtccacttcaggcagagatactgccgggcatt
tcgcgtgtcatgataccaaaataa

DBGET integrated database retrieval system