KEGG   Drosophila mojavensis: Dmoj_GI14054Help
Entry
Dmoj_GI14054      CDS       T01062                                 

Definition
GI14054 gene product from transcript GI14054-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmoj_GI14054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 515 aa AA seqDB search
MLTNRQFGMQLILLILLLALVAAKSKISAVREDIADYKDYKKLLRTKNNVLALYVSNPKE
AAAELKVFREAADGIRGTGTMLYVDCSNQERKKLCKKLKVTPKPYVLRHYKDGEYHKDYD
RQLTVESMITFMRDPTGDLPWEEDPAGADVLHFNDGASFTKHLRKDIRPMMVMFHVPWCG
FCKRMKPDYSKAATELKTHGGYVMAAMNVERHENAPVRKLFNLTGFPTLIYFENGKMRFT
YEGENTKDALVAFMLNPNLKPTPKPKEAEWSADTNSEIVHLTTQGFEAVLKDEKSALVMF
YAPWCGHCKNMKPEYEKAALEMKEKNVPGMLAALDATKESAIGEKYKVKGYPTVKYFSYG
VFKFDVNVREASKIVDFMRDPKEPPPPPPPEKSWEDEEDSTEVIFPNEETFSSILKRKKH
ALVMFYAPWCGHCKHTKPEFTAAANAMQDDPRVAFVAIDCTKYVNLCAKYNVRGYPTFIY
FSYLKTKLDYNGGRNSEDFIAYMKNPPSPKEHSEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgttgacaaaccggcaatttggcatgcagctcatactgctgattcttctgctggcactt
gttgccgccaaatcgaaaatatctgccgtgcgggaagacatagcagactacaaggattat
aagaagctgctgcgcaccaagaacaatgttctcgcgctctacgtatccaaccccaaggaa
gctgcagccgagttgaaagtgttccgggaagctgcagatgggatacgcggcacaggaaca
atgttgtatgtggattgctccaatcaggagcgcaagaagttgtgtaagaagctcaaggtg
acgcctaagccgtatgtactgcgtcactataaggacggcgagtatcacaaggactacgat
cgtcagctgaccgtggaatccatgatcaccttcatgcgcgatcccaccggtgatttgccc
tgggaagaggatcccgccggtgcggatgtattgcactttaatgacggagcttcatttacg
aaacatctccgcaaggatatccgtcccatgatggttatgttccatgtgccttggtgcgga
ttctgcaagcgcatgaagcctgactacagcaaagcagccacggaactgaagactcacggt
ggatatgtaatggctgccatgaatgtggagcgacatgaaaacgcacctgtccgcaagctt
ttcaatttaactgggtttcccacattaatttacttcgagaatggaaagatgcgcttcaca
tacgagggcgagaacaccaaggatgcattggtggccttcatgctcaatccaaatctgaaa
ccaacgcccaaaccgaaggaagctgagtggtcagctgatacaaattccgagattgttcat
ctgacaacgcagggctttgaggcggttctaaaggatgagaaatcggcactggtcatgttc
tatgcaccctggtgtggtcactgcaagaacatgaaaccggaatacgaaaaggcagctctt
gagatgaaagagaagaatgtgccaggcatgcttgctgccctggatgccaccaaggagtct
gccattggcgagaaatacaaggtcaagggctatccgacagtgaaatacttttcctatggt
gtcttcaaattcgatgtaaatgtgcgcgaggcgtccaaaatagttgactttatgcgcgat
cccaaagagccgccaccacctccgccgccagagaagagctgggaggatgaagaggacagc
acggaggtgatatttccaaacgaagaaactttcagctcgatcctgaagcgcaagaaacac
gcgctggtcatgttttatgctccatggtgtggacactgtaagcacacaaagccggaattc
acagctgccgcaaatgcgatgcaggacgatccgcgcgttgccttcgttgccatcgactgc
accaaatatgtaaatctgtgtgccaagtacaatgtgcgcggctatcccaccttcatatac
ttttcctacctcaaaacgaaactagactacaatggcggacgaaacagcgaagatttcata
gcctatatgaaaaatccacctagccccaaggagcatagcgagctgtga

DBGET integrated database retrieval system