KEGG   Drosophila mojavensis: Dmoj_GI14058Help
Entry
Dmoj_GI14058      CDS       T01062                                 

Definition
(RefSeq) GI14058 gene product from transcript GI14058-RB
  KO
K15293  
protein unc-13 A/B/C
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 3073 aa AA seqDB search
MSSTTATNTPMPFKPSSVAEADLLLQSSFAVPATKAINISVIEGVEAKAEPYSVAANALH
SQFKIKQQLKQQELDAAKVKELQSHRQHLHQQTQQPEQQQQLDAAKIKELQNHRQHHHQQ
PQPSQQHSELSLLSDNLSMSMSRLNLNNGSMASIRSEQQLCQLYNSQQHSDYIISDYMDK
IATRISLLETELKFAWRALDLLSNEYGKIWTRLEKLENISAEQQSVVGNLMGLIQTKQQE
ELQLPNSQIPFAAFIAGSQLLPMELELDENMVILNESKTEKSNFRHILEEFKVNHDDLYL
DEAGAYALDLDNNSENQYVQVNKTDHLLKDQQQQQQKQLQLDECDWLANAADVNQSAARA
RSRAKLYSESDLLMYEQQQIMANNARAELLQEFLNGQRVLEEVAASASASASAPLNCSLR
NIQSPKRSSQELLADTSSELDQLADEVKFFRLTAVKSGQGGNEIVPIEDPGGTTNDCEIN
ENFYKNLNEAYRDNDMTTEISNVERLLQQSEIAHDSLTNEQLPVPLMLAETTTNFSKEAT
EPTAFKGKELRKHRKKKHHKNEMDMINNLKHILAQASNTDKTPDSNSNNNQLDLSSDGNF
GGTTIFSSSEDAREENIAVLDAMTDVIIREINKISDLQSLSGSQILKLRQTIRAEQTFFE
KLNQVDKHLTLLLLNPVTMAEELRRLRVIEADKKFELVMKKFEKNIDTLKKLVGNSFEQY
KIKKSTQLNSKSVAHSKYNSETNIIQVGSDSQTATSSNDYSAHLLRNNSDLDEQLKLLET
QEIEINRKQNIDKITKNREFELEAVNSREPLSSSPSPIDQQRKSFSFTEQPLTNIYNQDE
YIRSLKKSLERHNSMLFLLHLQNPDKHKEAAITDLDDILLGISGSSPPPPAPNDNVFDNL
LDIPGANIFAQQLLKPQQQPLQQQPQLRAKSDSVLSSMSGWPLNSNENTSFSKCNDITVE
MIQMMIELQTSADLKLNKLNKVNNISADSNIDINMYQQPKLDSDYVFSEENLNYIHELSK
NIPICSAYENKSMFSESNPNQHSNEPISTIDEMLKWDQRKLQSNNKTTKLFSDDNNMNVS
ATSTKPFIMPDILKNELSQDLNRSMISTNGYMETDIDQTPQRHALTDRLVYYPTFNGISD
YNSSNNLDYLGLCHQSNKHHQSSSSVSSLHISQHEPSSSKKSADSQQLYSARSYKSYGKT
IESKPPKVWNKLSNLLPDNLKLKRYTRYKRSQSLPGGDAGIGQRNSQMPVRGQAGSYPFA
KGTASATGTLSAPIDPIGSQREDLTKRIQKLPMRIMQRATDSSAVLATKQKKQRSFSNKM
NRIMQKAKSYKRHSFNLRHGSSISDTELDVSAASTIDIASTSPLDVSIVAAAEEINDCSQ
AAYEPKIFNVPSLMVAMTSSDISDPQLTEHNHQDQQQHHHVQSLDIPNSLNYVSSREDDD
NRSQHSGRTLSSSRRQSTEDSIDTDDEYFCYELRHLEELEAEALAKAGPEQNSYAQHSDN
EVLFTQIGQLVLRDSVCCTESDYVPDETVKLKMSEVLNELRCVVQLKPADTDGRPPKADE
SELLGKQKQTKLVQVSDMHRAWQDVNNEYQLPISSKSQETAIGTAASVEPQVSTQVNKKK
QRKGDRSKTTNQRQDELQSASSSSYSSSDDEHEYEYKQKHRSYPPPSPLQLDDDQPIESS
SATSGPDTPAAQSDEMYDNLDKNGAAYAQPDTDPDIVQKANGEKEAAASAEFPEARSELI
DINKSVVNVANSPESNLPAADSTTVVNASPFKLISFDSSVEGSQVAAPNSAGLNLGTSKW
KLLKTLKERKIEERNNLDKMKEEEMAKDKEKNGTGTGDVGLRSNGHPGDNPFYSNIDSMP
DIRPRRKSIPLVSELVLKTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPIS
STTPHNFVLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAE
KSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRDVFSIEEKSHTGHMKAVKQSVLD
GTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHF
ECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRT
DKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPTQKGDDAW
KLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAH
TTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSQEKLMDLKSTV
DLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEA
KRDTDDHGPKLDSVDFWHKLIALIVSVIDEDKNSYGAVLNQFPQELNIGQLSAATMWGLF
AVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPEYPAWFEPFVMQ
WLNENDDVSLEYLHGAFNRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDP
EIWKRYMRRFAKTIVKVLIAYADIVKMEFPEHMRDERIACILMNNIQQLRVQLEKMFESM
GGDKLEEDAANILKELQQNLNSALDDLASLFAISLEPRITQSVRELGDMLLSIKGGSGNL
TAGNQAIQRNAVAVEADDVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEK
TIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKE
VEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSAELQSLRYALSLYTQMTDTLI
KTFISSQVHEVDPENADESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFR
PFVEINLIGPHLQDKKRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCF
ARDDRLVGVAVIPLKDISEKGSVACWLPLQRRIEMDETGWTILRILSQRNNDEVAKEFVK
LKSEIRQEPTMGT
NT seq 9222 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaacaacagcaacaaatacaccgatgccatttaagccatcatcagttgcagaa
gccgacttgctgctgcagtcatcattcgcggtgccagccaccaaagccattaatatatcc
gtcattgaaggagtcgaggccaaagcggagccctacagcgtggctgcaaatgcattgcac
agtcaatttaaaatcaagcaacaattgaagcagcaagaactggatgcagctaaggttaaa
gagcttcaaagccatcgacaacaccttcatcagcagacccagcagcccgagcagcagcaa
caactggatgcagctaagattaaagagctgcaaaaccatcgacaacaccatcatcagcag
ccccagccgtctcagcagcattcagaattgagtttgcttagcgacaatctgtccatgtcc
atgtccagattgaatctaaataatggcagcatggcatcgatcagaagcgagcaacaacta
tgtcagctctacaattcgcaacagcattcggattatattatctcagactatatggataag
attgcaacacgaattagtttgctagaaacagagctgaagtttgcatggcgggctcttgat
ttactgtcaaacgagtatggcaaaatttggaccagattggagaaattggaaaacatctct
gcagaacaacaatctgtagttggaaatctaatgggtctcattcaaacgaagcagcaagaa
gaactgcagctgccaaattcccaaattccgtttgcagcatttatagcaggaagtcaactg
ttgcccatggaattggaattggatgaaaatatggttatattgaatgaatcgaagacagaa
aaatccaactttcgtcatatcctggaggaattcaaagtgaatcatgatgatctatattta
gacgaagccggtgcctatgccttagatttggataataacagtgaaaaccaatatgtgcaa
gttaataaaacagaccacctactgaaggatcagcagcaacagcagcaaaagcagctacag
ctggatgaatgcgattggctagcaaatgcagctgatgtgaatcagagtgccgctcgagct
cgatcccgagcaaaactttactccgaatcggatctgttgatgtacgaacagcaacagata
atggccaacaatgccagagccgaattattgcaggaatttctgaacggccaaagggtgctg
gaagaagtagctgcatcggcatcagcatcagcgtcggcacccttaaactgtagtttgcgt
aatatacaaagccctaagagatcatctcaggaattgttagctgatacgtcttctgaactc
gaccagctcgctgatgaggtgaagttttttcgtttaacagccgttaaatccggccagggt
gggaacgagatagtaccgatagaagaccctggaggtacgacaaacgattgtgagataaat
gaaaacttctacaagaatttaaacgaagcatatcgcgacaacgatatgactactgaaata
agtaatgtggaacgattgttacagcagtccgaaatagctcacgactcattgactaatgaa
caattacccgttccgcttatgctagccgagactactacgaattttagcaaagaagcaacg
gagccaacggcatttaaaggtaaggaattgcgaaaacatcgaaaaaagaaacatcacaag
aacgaaatggatatgataaacaatttgaaacatattcttgcccaagcatccaatacggat
aagacacctgattcaaattcaaataacaaccagttggatttgtcatcagatggaaacttt
ggaggcacgacaattttctcatcttcggaagatgcgcgtgaagaaaatattgccgtacta
gatgccatgactgatgttataataagggaaataaataaaataagcgatctacaatcatta
tcgggatcccaaatacttaagctaaggcagacaatcagagctgagcaaactttctttgag
aaactgaatcaagtggacaagcatctaacgttacttctcttaaatcctgtcaccatggcc
gaagagctgagacgtttgcgggttattgaagctgataaaaaatttgagctggtaatgaaa
aaattcgagaaaaatatcgataccttaaagaaactagttggaaattcgtttgagcaatat
aaaataaagaaaagcacacaattaaattccaaatccgtggcccattccaaatacaattca
gaaacaaacataattcaagttggctccgactcacagacagcaacttcttcgaatgattat
agcgcccatttgttacgtaataattctgatttggatgaacaattgaagttattagagacc
caggaaatcgaaataaatcgtaaacaaaatattgataaaattacaaaaaatcgtgagttc
gaactggaagcggtcaatagccgagaacccttatcgtcgagcccgagtccaattgatcag
cagcggaagagtttcagttttactgaacaacctttaacaaatatttacaatcaagatgag
tatataaggtcgttaaaaaaaagtcttgaaagacataatagtatgctgttcctgttacat
ttacaaaatcccgataagcacaaagaagccgctatcaccgacttggacgatatattgttg
ggaataagcggctcaagtcctccaccgccagcgcccaatgataatgtattcgacaattta
ttggacatacctggtgctaatatatttgcccaacagctacttaagccacaacagcagccg
ctgcaacaacagccacaactacgagctaaatctgactctgtactatcgtctatgagtggc
tggccattaaattcgaatgagaataccagttttagcaaatgcaatgatataactgttgaa
atgatacagatgatgatagagctacagacgagtgccgacctcaagttaaataagttgaat
aaagttaataatatcagtgctgactcaaatatcgatattaatatgtatcagcagccaaaa
ttggatagcgattatgtatttagcgaggagaacctcaactatatacatgagctatccaaa
aatataccaatttgctcagcatatgaaaataaatcaatgttttccgagtcgaatccgaat
cagcattctaatgaaccaatttcaacaattgatgaaatgctgaaatgggatcaacggaag
cttcagtcgaacaacaaaacaactaaactattttcggatgacaataatatgaatgtcagt
gcaacaagcacaaagccattcataatgcctgatattttgaaaaacgaattgtcgcaggac
ctgaatagatcgatgatctcaacaaatggctatatggaaacggatattgatcaaacaccc
caacgccatgctctaacggatcgtctcgtttattatcccacgttcaatggcatttctgac
tataacagcagcaataatctggattatttgggactttgtcatcagtcgaataagcatcat
cagtcatcatcgtcggtgtcatcattgcacattagtcagcatgagccgtcaagctcaaag
aagtcggcggactctcaacagctatattcggctcgatcatacaaatcgtatggcaaaacc
attgaatcgaagcctcctaaagtttggaataagttgtccaatctgttgccggacaatctg
aaactgaagcgttatacgagatataaacgctctcagtcgctgcctggtggcgacgccggt
attggtcaacgaaactcacaaatgccggttcgtggccaggctggttcgtatccgtttgcc
aaagggactgcctctgccactggcaccttgagtgcaccaattgatccaattggaagtcaa
cgtgaggacctaacgaagcgtattcaaaaattaccaatgcgtataatgcaacgagcaact
gattctagtgccgttttagctactaagcaaaagaaacaacgttcattctctaacaaaatg
aataggataatgcagaaggcaaaatcatataaacggcacagctttaacctgcgccacgga
tctagcatttcagataccgagttagatgtcagcgcagcgtctaccatagatattgcttca
acttctcccttagatgtttctatagttgctgctgcggaggaaatcaatgattgctcgcaa
gcagcgtatgagcctaaaatatttaatgttccctcactcatggtggcaatgacgtcgtcg
gatattagcgacccacagttaactgaacataatcatcaagatcaacaacagcatcatcat
gtgcagtcgttagacatacctaacagcctcaactatgtctcatcgagggaggacgatgac
aatcgtagtcaacattccgggcgcacgttgtcctcgtcacgtcgccagagcaccgaggat
agcattgacacagatgacgaatacttttgctatgagctgcgacatttggaggagctcgaa
gctgaagcgttggcaaaagctggacctgagcaaaatagttacgcgcagcattcggacaat
gaagttctctttacacaaattggtcagttggtgttgagggatagcgtttgttgtacagaa
agtgactacgtcccagatgagacggttaagctcaagatgtctgaggttttgaacgagcta
agatgcgttgttcagctgaaaccggcggatacagatggtcgtcccccgaaagcagatgag
tccgaattactggggaaacagaagcaaacaaagttagttcaagtctcagatatgcataga
gcttggcaggacgttaataatgaatatcagctgcctatcagctccaaatcacaagagaca
gcaataggaacagcagcatcagtagaaccacaagtgagcacacaagtcaacaaaaagaag
cagcgaaagggcgacaggtcaaaaactactaaccaaagacaggacgagttgcaatcggca
tcaagttcatcatactcatcaagcgacgatgagcatgagtacgaatacaagcaaaagcac
agatcataccctccaccctctcctcttcagctagacgatgatcagccaattgagtcatct
agtgccacatctggtccggatacgccagcagctcaaagtgatgaaatgtatgacaatttg
gataaaaatggtgctgcctatgcgcaaccagacaccgatccagatattgttcagaaggct
aatggagaaaaagaagcagctgcatccgccgagtttccagaagcgaggtccgagctaatc
gacataaataagagcgttgtgaatgtagcgaactcaccggagagtaatttgccagccgcc
gattcgacaacagttgtcaatgcgtcgccttttaagcttattagttttgactcaagtgtc
gaggggtctcaggtggctgccccaaacagtgctggcttgaacttgggcacaagcaaatgg
aaattgttaaaaactttgaaagagcgtaaaatcgaggagagaaacaatctggataaaatg
aaggaagaagaaatggctaaagacaaggagaagaatggcaccggaacaggcgatgtgggc
ctacgctccaatgggcatccgggggataatccattctacagcaatattgacagtatgccg
gatatacgtccacggcgcaaatctattccccttgtttctgagctggtgctcaagacaatg
gcagctacaaaacggaatgctggactcacatcggcagtgccccgggcaacgctcaatgat
gaagaactgaaaatgcatgtctataaaaaggcactgcaggcgctcatatatccaatatct
tcgacgactccacataattttgtactttggacggctacctcgccgacttactgctatgag
tgcgagggattgctgtggggcatcgcaaggcagggagtgcggtgcacagagtgcggagtc
aaatgccatgagaagtgtaaggacttattgaatgccgactgtctacaacgtgccgctgag
aagagctccaagcatggtgccgaggataaggccaattcgataattacagcaatgaaggat
cggatgaagcaacgcgagcgggaaaaaccggaaatatttgagttgatcagagacgtgttc
agcattgaggagaagagccataccggccatatgaaggctgtaaagcagagcgtcctcgat
ggaaccagtaaatggtcggcaaagatcgcaatcacagtgatttgtgctcaaggcctgata
gcgaaggataaaagcggtaccagtgatccatatgtgacggtgcaggttagcaaggtgaaa
aagcgaacacgcacaatgccgcaggagctaaaccctgtgtggaacgagaagtttcacttc
gaatgtcacaactcttcagatcgtataaaagtgcgagtttgggatgaggataatgatctt
aagtcgaaattgcggcaaaagttgacgcgggaatccgatgattttctgggccagacaatc
atagaggttcgaactctctctggtgaaatggatgtgtggtacaacctagagaagcgcacc
gacaagtctgccgtatcgggtgctatacgactccatatctcggttgaaataaagggtgag
gagaaggtagcaccttatcatgtccaatacacctgtttgcatgaaaatctctttcactac
ctgtgtgaggaaaacagcggcatggtaaagctacccacccaaaaaggcgatgatgcatgg
aagctctattttgatgaaattcccgaagaaattgttgacgagttttcaatgcgttatggt
atcgaaaatatatatcaagcaatgactcattttcactgcctttccgctaagtatctctgc
ccgggagttccagccgtcatgagcactctattggcgaatattaatgcatattacgcccac
acgaccgcttcttctgcggtttcagccagtgatcgttttgcagcgagcaactttggaaag
gaaaagttcgtaaaactgcttgatcagctgcataattcgttaaggattgatctatcgatg
tacagaaataactttcctgcttcgagtcaagaaaaactaatggatcttaagtcaacagtt
gatctcttgactagcattacatttttccgcatgaaggtgcaagagctgtcgagtcctcca
agagcaagtacagttgtgaaggattgcgtgaaagcttgtcttagatccacctatcaattc
ctctttgagaactgttacgagctctacaatagggagtttcaggtggatccaaacgaagcg
aaacgtgatactgatgaccatggcccaaaactagatagcgttgacttctggcataagctg
attgcattgattgtatctgttatcgatgaagacaaaaatagttatggggcagtgctcaat
caatttccccaggaattgaacattggacagctatcggcagctactatgtggggccttttc
gccgtggacatgaagtacgcgcttgaagagcatgagcagcatcggctttgcaagtcatct
gcttacatgaacttgcactttcgtgtcaaatggctatatagtaactatgtaaaggaggtg
ccaccctataaaggagctgtgccggagtatccagcttggtttgagccgtttgtcatgcaa
tggttaaatgaaaatgacgatgtctcgttagaataccttcatggtgcatttaatagggat
aaaaaggacggtttccaaaagagcagcgaacatgccctgttctcgaattctgtagtcgac
gttttcacacaactgacgcaatgcttcgatgttgttagcaagctcgagtgtccagatcca
gaaatttggaaacgttacatgaggcgttttgctaaaacaatcgttaaagtgctaattgcc
tatgctgatattgtgaaaatggagtttccagagcatatgagggacgaacgaattgcctgc
attctgatgaacaacatacaacagttaagggttcaattggagaaaatgttcgagtccatg
ggtggggacaagttggaggaagacgcagccaacattttaaaagagctacaacagaacctt
aactcagcccttgatgatttggcttcactgtttgctataagtttggagccacgtataaca
caatcggtgcgtgagctgggcgacatgcttctgtcgattaagggaggaagcggaaatctc
acagccggcaatcaggcaatccagcgaaatgcagtagctgtggaggctgatgatgtgttg
aggcctctaatggacttacttgatggatctttaactttgtatgcccagtcgtgtgaaaag
acagtgctgaagcgcttgcttaaagaactttggaagatagtgatgcgaattttggaaaaa
actattgtactgccaccaatgactgataaaactatgatgttcaaacatttaacggataat
gcaaagaatttggcatcaaacgccaaaatagaagacatgggacgtttgtttaagtcacat
atggcaggaaaacaggatgtgaaaagtgctcttagcggtgttatggatatatcaaaggaa
gtcgaaaagaacctatctcctaaacaatgtgccgtacttgacgttgccttagatacaatt
aaacaatatttccacgccggtggtaatggcctcaaaaagacatttttagaaaagtccgca
gagttgcagagcttgcgatatgcacttagcttgtatacgcaaatgacagacactctgatt
aagacattcatctcaagtcaggtgcatgaagttgatccagaaaatgcagatgaaagtgtt
ggtgaaatatccgtgcagatagatcttttttcacatccgggcacaggagagcacaaagtg
aacgtgaaagtcgtggctgccaatgatctgaaatggcaaataccgtcgggcatgttcagg
ccattcgtggagataaatcttattgggccccaccttcaggacaaaaagagaaaatttgcg
accaaatcaaagtcgaataactggtctcccaaatacaacgaatcattcagcttcactatc
ggaaatgaagagcagctcgatttcttcgagcttcacatttgtgttaaggactattgtttt
gcccgagacgatcgccttgtgggagttgcagtgataccattgaaggatatatcagaaaag
ggatcagttgcgtgttggctacctttgcagcgtcgtatcgaaatggatgaaacaggttgg
accatattgcgtatactatcgcagcgaaataacgatgaagtagccaaggaatttgtcaag
ctcaaatcagagatacgtcaggagccaacaatgggaacataa

DBGET integrated database retrieval system