KEGG   Drosophila mojavensis: Dmoj_GI14373Help
Entry
Dmoj_GI14373      CDS       T01062                                 

Definition
GI14373 gene product from transcript GI14373-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dmo  Drosophila mojavensis
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dmoj_GI14373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 897 aa AA seqDB search
MVLSTLHISVDNDVAGEQQQQQLTTTAAAIVPNRLNVLCNNNNNNNQIMNNNNKEPPQML
VEKENEQQGFSLSSHSNSMNNNKYCDMNGNATNNEQLWQQQQQQQQQQQQHQGSSSASNT
PYRSGSALRRGTQIQRSSMRLRQQQASEQLRRRREEEERIAQQNEFLRNSLRGSRKLKAL
QDTATATPTAGKALAQQQHATTAATTIAGVENEAYLPDEDLMPAEHIDGYGELIAALTRL
QSQLAKSGLSNLAGRVSAAHNVLATASVAHVLAARSAVLQRRRPRVAGPVHSGALGLQKE
IVELLTQSNTASAIELGNLLTSHEMEGLLLAHDRIASHTDASPSPMPTPMPTPTPSQTPT
ATATTLSGHSSPVAGAKAAGTAAASSRAAMAVLPPVVPPVASSVAQRGAMPLPVAVGVRG
ESPPGMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLL
HEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPPGGGLCSGLGMHHVGG
MAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEED
QTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKEGATSKGATLLCARKGRKKKKKASS
EAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADS
ERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIR
TVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDI
IATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgtcgactttgcacataagcgtggataacgatgttgctggcgagcagcaacag
caacagctaacgacaacagcagctgcgatcgttcctaacagattaaatgtgctgtgcaac
aacaacaataataataatcaaattatgaacaacaacaacaaggagccgccacaaatgtta
gttgaaaaggaaaatgagcagcaaggcttcagcttgagcagccacagcaatagcatgaat
aataacaaatattgtgatatgaacggcaatgcaacgaacaacgaacaactctggcagcaa
cagcaacagcaacagcagcagcagcagcagcatcaaggatcgtcatctgccagcaatacg
ccgtatcgcagcggctcagctctgcgacgtggcacacaaattcagcgctcttcgatgcgt
ttgcgacaacaacaggcaagtgagcaattgcgacgtcgacgcgaggaggaggagcgcatc
gcccagcagaatgagtttctacgcaacagcttgcgtggctcacgcaagctcaaggcgctt
caggatacggccacagccacgcccacggccgggaaggcgctcgcgcagcagcagcatgcg
actacagcagcaacaacaattgctggcgtcgagaacgaggcatatctgccggatgaggac
ctaatgccagcggagcacatcgatggctacggggagctgatcgcggcactgacgcgtctg
cagagccagctggcgaagagcgggctgagcaacctggcgggccgagtgtcggcggcgcat
aatgtcctggccaccgccagtgtggcccatgtgctggccgccaggagcgcggtgctgcag
cgcaggcgcccgcgggtggccgggccggtgcactccggggcgctgggcttgcagaaggag
attgtggagctgctgacgcagtcgaatacggcgtcggccattgagctgggcaatctgctg
accagccacgagatggagggcctgctgttggcgcacgatcgcattgccagccatacggac
gcgtcgccctcgcccatgccaacgcccatgccgacgccgacgccctcacagacgcccacg
gcgacggccaccacgctgagcggccacagcagtcccgtggctggagccaaggcagcgggc
acggccgcagcgagcagcagagcggctatggcggtgctgccgccagtggtgccgccagtg
gccagctcggtggcgcagcgcggagccatgccgctgcctgtggcggtgggcgtgcgcggc
gagtcgccacccggcatgagcgcctgcttcggcacgctgaacgaccagaacgacaacata
cgcatcatacagatcgagaagtccaccgagccgctgggcgcaacggtgcgcaacgagggc
gaggcggtggtcatcggccgcatcgtgcgcggcggtgccgccgagaagtccggcctgctg
cacgagggcgacgagatactggaggtgaatggccaggagctgcggggcaagacggtgaat
gaggtgtgcgccctgttgggcgccatgcagggcacgctcacgttcttgattgtgcccgcc
ggcagtccgccgcccggcggcggcctctgcagcggcctgggcatgcatcacgtgggcggg
atggcgcatcgcgatacggccgtgctgcacgtgcgggcacacttcgactatgatccggag
gatgatctgtacataccgtgccgggagctgggcatcagcttccagaagggcgatgtgctg
catgtgatatcccgcgaggatcccaactggtggcaggcgtaccgcgagggcgaggaagat
caaacgctggccggcctcattcctagtcagtccttccagcatcagcgcgagaccatgaag
ctagccattgccgaggaggcgggtctggcgcgctcccgcggcaaggagggtgccaccagc
aagggtgcaacgcttctctgcgctcgcaaaggccgcaagaagaagaagaaggctagctcc
gaggcaggctatccgctttatgcgacgacagcgcccgacgaaacggaccccgaggagata
ctcacctacgaggaggttgcgctctactacccccgcgcaactcacaagcgccccattgtc
cttatcggcccacccaacattggccggcacgaactacgccagcgcctgatggccgactcc
gagcgtttctcggctgcagtgccacacacatcccgtgcccggcgcgagggcgaggtgccc
ggcgtggattatcatttcatcacgcgacaagccttcgaagcagacattctggcgcgtcgc
ttcgtggagcatggcgaatacgagaaggcctactatggcacatcactggaggccattcgc
acagtcgttgccagtggaaagatttgtgtgctgaacttgcatccgcagagcctgaagctg
ctgcgtgcctccgacctgaagccctatgtggtgctggtagcaccgcccagtctcgacaag
ctgcgccagaagaaactgcgcaacggcgagccgttcaaggaggaggagctgaaggacatc
atcgccaccgcacgagacatggaggcgcgctggggtcacctcttcgacatgatcattatc
aacaacgacacggagcgagcttatcaccagctgttggcggagatcaattcgctggagcgc
gagccccaatgggtgcccgcgcagtgggtgcacaacaatcgcgacgaatcataa

DBGET integrated database retrieval system