KEGG   Drosophila mojavensis: Dmoj_GI14543Help
Entry
Dmoj_GI14543      CDS       T01062                                 

Definition
(RefSeq) GI14543 gene product from transcript GI14543-RA
  KO
K03245  
translation initiation factor 3 subunit J
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI14543
Ribosome biogenesis [BR:dmo03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    Dmoj_GI14543
Translation factors [BR:dmo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dmoj_GI14543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 230 aa AA seqDB search
SAADSEIVIRPNAANNINKWEGEDDDEDVKESWEDEEEKKDEEKPTKTEAPVKTKPNKAL
KAKLEEQERLKEEEEQKRLAEMTPEEKLAEKLRLQKIQEESDLKSALETFGVTSIGGGLD
AFNPESKEEFKEFGATLSWKVAQYRESIHFPQFIEDLVRSLCCNLSAADIKKVKMSVESL
HSEKLKMEKAAAKKSAMKGKGKVSLRTENDDIDGYQKYGNDFTDDYDDFM
NT seq 695 nt NT seq  +upstreamnt  +downstreamnt
aatccgccgccgacagtgaaattgtcatacgaccgaatgcagctaacaacataaacaagt
gggagggcgaggacgacgacgaagatgttaaggaaagctgggaggatgaagaggaaaaga
aagatgaggagaagccaacgaaaacagaagcgccagtcaaaactaaacccaataaggcgc
taaaagcgaaattggaggagcaggagcgccttaaagaagaagaggaacagaagcgtttag
ctgagatgacacccgaagaaaaattagcggaaaagctgcgcttacaaaagattcaagaag
aatcagatctaaagagtgctctagaaacattcggtgtcacaagtataggcggtggactcg
atgccttcaatccggagagtaaagaagaattcaaggagttcggtgccacgcttagctgga
aggttgctcaataccgagaatccatacactttccacaattcatagaagatctagtgcgca
gcttatgctgtaacttgagcgctgctgatattaagaaggtcaaaatgagtgtggagagct
tgcactcggaaaagcttaaaatggaaaaagcagctgccaagaaatcggccatgaagggca
agggaaaagtttcgttgcgaacggaaaatgatgatatcgatggctatcaaaagtatggca
atgattttaccgatgattatgatgattttatgtga

DBGET integrated database retrieval system