KEGG   Drosophila mojavensis: Dmoj_GI14616Help
Entry
Dmoj_GI14616      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 461 aa AA seqDB search
MSDMKIPIGLAMSTRNILHFFPYLCPSSWRRRKRQEKQHLSYHDSGWLWACLLPLLLLLL
GNIRGSGAHLHKWDILQKSFRYMQETMLSNSLERAHLNYGIVFECRTISDASLGDEVHFH
LQLGDLRGFRRLDANKKLALFLHGWNDQGSKDWVQELLLTWTLFDEDYNVCVVDWGNLSQ
NDYKSASMSIFDVGLTVAGIIIALEEMRPQHFNRQNITLAGYSLGAHAAGYAGAVLGGQV
EQIIGLDPAGPLFTLPADVHPKYRLDKTDAKFVQVLHTSGGTLGTSLKCGHADFYPNGGR
APQSNCLMFMNLRDMQNTNPIACSHSAAAIFFRQSMDPQYPFIGYECDSYRAYRAGYCDN
NRRAVFGIHSRRWIQGSFYFDTSSSHPYVQRQRPHRRWNWIWDRSHNRNRISARHSAEDE
AITLTATATAMATTADPLGRTPQWTRRWLRRSRERHRCPSR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatgaaaattccgattggtttggccatgtcaactcgtaatattttgcatttc
tttccctatctctgccccagcagctggagacggcggaagcgacaagagaagcaacacctt
agttaccatgattctggttggctgtgggcctgcctgctgccgctgctgctgctgctgctg
ggcaacatccgcggctctggcgcccatctgcacaaatgggatatcttgcagaagagtttt
cgctacatgcaggagacgatgctgagcaacagcttagagcgcgctcatctcaattatggc
attgtgttcgagtgccgcaccatctccgacgcgagtctgggcgacgaagtgcacttccat
ctgcagctcggagacctgcgcggattccgtcgcctggatgccaataagaagctggcgcta
tttctgcacggctggaacgatcagggcagcaaggactgggtgcaggagctcctactgact
tggacgcttttcgacgaggactacaatgtgtgtgtcgtggactggggcaatctgtcgcag
aacgactacaaaagcgcctcgatgtccatcttcgacgttggcctgacagtcgccggcatc
atcattgccttggaggaaatgcggccgcagcacttcaaccggcagaacatcaccttggct
ggctatagcctgggagcccatgcggctggctatgcgggcgccgtgctgggcgggcaggtg
gagcagatcattggcctggacccggctgggccgctgttcacgctgcccgcggatgtgcat
cccaagtaccggctggacaagacggacgccaagttcgtccaggtgctgcacacctcgggc
ggcacgctgggcacgagcctgaagtgcggccacgccgacttctatccgaatggcgggcga
gcgccccagagcaactgtctgatgtttatgaatctgcgcgacatgcagaatacaaatccc
attgcctgcagtcattcggccgcggcgattttcttcaggcagtctatggacccgcagtac
cccttcattggctacgagtgcgatagctatcgtgcctatcgcgcgggctactgcgataac
aatcggcgagccgtattcggcatccactcgcgccgctggatacagggtagcttctatttc
gacaccagctcgagccacccctacgtgcaacggcaacggccgcatcgccgctggaattgg
atttgggataggtctcacaatcggaatcgcattagcgccaggcactcagctgaagacgaa
gcaattacactaacagcaacagcaacagcgatggcaactaccgccgaccctctgggccgc
actccgcagtggacgcgaaggtggctaaggcgcagccgtgagcgccatcgctgcccgtcc
agatga

DBGET integrated database retrieval system