KEGG   Drosophila mojavensis: Dmoj_GI14627Help
Entry
Dmoj_GI14627      CDS       T01062                                 

Definition
(RefSeq) GI14627 gene product from transcript GI14627-RB (EC:2.3.1.48)
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI14627
   04330 Notch signaling pathway
    Dmoj_GI14627
   04350 TGF-beta signaling pathway
    Dmoj_GI14627
   04068 FoxO signaling pathway
    Dmoj_GI14627
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI14627
Transcription factors [BR:dmo03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dmoj_GI14627
Chromosome [BR:dmo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dmoj_GI14627
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dmoj_GI14627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 3233 aa AA seqDB search
MMADHLDEPPQKRVKMDQTDLYFLEDNLPDELVSSSSGWSDQLNTGGGGGGGVGGVVSTA
SGVVGAGGPNKPPTQGPGPGVVPPQMNGAGGGGDDGSGNGGSGAAGSQLRQLQHHQHLQQ
LLQHQQQGNKGAGGGMVVPGMNQLGSKSPNLQSPNTAGMQVATQMGMVNSMPMSISNNGN
NGMNSIPGMNSIAQGNLGNMVLTNSGGMGTIGGAGLVNTLKQPGGASMMSTVPGSVGVSS
VTGAAPSQGMHMQNGPMMGRMVGGQQHLLRGPHLMGGGAGGGNGPGGVVGAGGGPRMQNP
NMQLGQINNMPYGVGNYGAPGSNNTQLLAQQMAQRGAGGVGGVVAPNMSAGMAQANRPIG
TVVPMSNLGGDGAPPGAGGLVGNTQQQQQQLAAANAQMNSQQQQQQQPPGVQQGAMGPRA
PQPNQLLGHSQQQQQQQQPGTSQQQQAIASGVASSVSVAAPAPASSNMTDERKKQIQQQL
MLLLHAHKCNKRENMNPNREVCSVNYCKAMKAVLAHMATCKQSKDCPMQHCTSSRQILLH
YKTCQRSDCIICSPFRQNNSLFQNASGGGGGGGAAVAPNASPLQQQQQQQQQQQQQQLPQ
GQQQVPQNPSGVGVGVGGGVGVGVGVGVDTKQVAQSAGTCGAPNTAIVLPQQQAAGASNV
PKGNTDMGQQQQQQQHQQVQQQELRRFEGVGSIGQVGPVPAGMLGAPGQGMAPGIRMQGA
PSVRVLGVQPGQPGSTMASGGVPVPVPVPGQNVLPGANDVGSLQQQQQQAAQAAQQSGQL
MLQGCNTGTGGRRRALQNMVDQQQQPNAQQQSVQQQQQQQLGNIPAPLSVNVGFNNANFV
GVGDKQQQQQQQQQQQQQLVGQSDQMTKLKLQAQAQAQVQAHVNVVSAGGAPGSGNSASG
GASVLMPADTTGGANSASAGSNAVGTGAGGAAGGGAPGNGSDSEKDWRESVTADLRNHLV
HKLVQAIFPTSDPTTMQDKRMHNLVTYAEKVEKDMYEMAKNRSEYYHLLAEKIYKIQKEL
EEKRLKRKEQHQQQLLQMQQGGPNSSVVNPTSVPNNALQQQQQPGQGVRPNISPMGGGGG
GGGGPSGMMQQQMRPQAPGMGVGVGVGQQQQTAAGQANMVAVAASMRSHSPGGNMLAIQQ
QQRMQFPQQQQPGQGNMLVGPPGPSPGGMVANPVLSPFNTQQTMQSATAVGGGPGILTSP
VPGQQQQQQQQQQQQQQQFINANGSSGAQNSQISEIMKQRLLQHQQQTNAAAMLLPQSPF
NNATPIQQPQQQQQQQQQQQQQQQQQQQQQQQQQQTNAFSSPMQQKTQPPGSVLNNMPPT
PTSLDALNAGAASAGAGSIGGGTVAAPSPSPSFMSNGPIGTPSNNPPSVSSLMQPLSNRA
ATPPYIPTSPVPATSASGLTASSTPASAAATCSSSGSGSSTSSSAVVTTTTVTTPLSCAS
SSGTTPTSTTTSTSGNGSATPASSTLLQMARSNSENSAPGRVMSSSSSLSSQMAALEAAA
RDNDDETPSPAGANDTNGSNGGSGGGMASKGKLDSIKQEDDIKKKFMDDSCGGNGDSSQM
DCSTGGKGKNVNNDGTSMLKMEIKTEVGADVKPIKSDPMDVDESAVSSGIAGGANGDGTI
GGSGVDSKDDINGAIDGVSSGLAADIKLKSETKPHVPEPLAPNAGDKKKKCQFNPEELRT
ALMPTLEKLYRQEPESVPFRYPVDPQALAIPDYFEIVKKPMDLGTIRSNILNGKYSDPWE
YVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEQEIDPVMQALGYCCGRKYTFNPQVLC
CYGKQLCTIPRDAKYYSYQNSLKEYGVASNRYTFCQKCFNDIQGDTVTLGEDPQQSQTQI
KKDQFKEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKEN
KFNAKRLPTTKLGVYIETRVNNFLKKKEASAGEVHIRVVSSSDKCVEVKPGMRRRFVEGG
EMMQEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPR
QYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWY
KKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEK
RKQAEAAEAAAAANLFSIEDNEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGND
LSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHY
EFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNNCKTAVETRYHCTVCDDFDLCTVCKEKV
GHPHKMEKLGFDLDDGSAPADLKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQK
MKRVVQHTKNCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVPFCPNIKHKLKQQQLQQ
KLQQQQLLRRRVALMSRTAAPAALPGPAVSGPVVASGAVGVGGPVVGMSGVAVSQQVMSG
QAAIMPAGGGGMSPSTVAVPSPVSGAVMAGMTSPHPHQPGIGMKPGGHSPSPNVLQVVKQ
VQEEAARQQVPHGGSFGKGVPMAPPVMQRPMGVGVSNQGGMGGMVSNVGGNQLAGNVGVV
PGGGQLPSGANCNNILNANNLLPLDQWGGSGGPGQQRYTNNAPNQPGMRQPNQLMQQNIQ
QQQQQMMGMPPNQLGVGVGVGVGAGQMPVVGSGVNMGGGGAPHSIGLGSQIGAAASGGGV
RPPGAQGVGGGGAGGAGPNMGNGPPLNTQTLAHIMQKIKNNPTNESNQHILNILKQNPQI
MAAIIKQRQQSQINAAAGGAGGPPGAIQAGNGPQTPQQQQQQQQVMQQQQMQHMMNQQQQ
GPGPGPQQMGPGQQQQVSLMQAAQQQQQGPPHQRMANMQNTAMMLPNLPPGSQGGMVPNQ
NLNKMRYMPMNQYPPPYPQRQRGPHMGVFGQPPFPGGTAGNFNAGGGGNVSGIPVAGAAV
GSGASGPGSDQYSMANAAASNMLQQQQGGGGAGVKPGPQQQQQQQQQQMGVMPPGMQQQQ
PMQQQQQQQQMMQVVAAGGGGMSSTNPQNTLPGGGGGPSGPGANVMGPPTPHTLQQQLMQ
SARSSPPIRSPQPTPSPRSAPSPRGPSASPRAQPSPHHVMSSHSPAPQGPHDGLHNHGMH
HQSPLPGVPQDVGVSGVGVGVGVGVGVNAGNVGNAGGSLPDASDQLSKFVERL
NT seq 9702 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcatttggacgaaccgccacagaagcgggtcaaaatggatcaaacggat
ctgtactttctggaggacaatctgcccgatgagctggtgtcctccagcagtggctggtcg
gatcagctgaacactggtggcggcggcggtggcggtgttggcggcgttgtatccacagcc
agcggcgtcgttggcgctggtggaccaaacaaaccacctactcagggacctggtccaggc
gtcgtgccaccacagatgaacggagccggtggcggcggtgacgatggcagtggtaatggc
ggcagtggcgctgccggcagtcaactacgtcagctacagcaccatcagcatctgcaacag
ttgctgcagcaccagcaacagggcaacaaaggcgctggcggcggcatggtggtgccgggc
atgaatcaactgggcagcaagtcgcctaacctgcaatcgcccaacacggctggcatgcag
gtggccacacagatgggcatggtcaactcaatgcccatgtccatatcgaataatggcaac
aacggcatgaattccataccaggcatgaacagcattgctcagggcaatctaggcaacatg
gtgctgacgaatagcggcggcatgggcaccattggaggcgccggcctagtcaacacactg
aagcagccaggcggggcatccatgatgagcactgtgcccggctcggtgggcgtgagctcg
gtgaccggcgcagcgcccagccagggtatgcatatgcagaatggaccgatgatggggcgc
atggttgggggacagcagcatctgctgcgaggcccgcacttgatgggcggcggagctggc
ggtggcaatggaccgggcggcgtagtcggagccggcggcggcccccgcatgcaaaacccg
aacatgcagctgggccaaatcaacaatatgccttatggagtcggcaactatggtgcaccc
ggcagcaacaacacgcagctactcgcgcagcagatggcgcagcggggcgctggtggcgtc
ggtggcgttgtcgcgcccaacatgagcgccggtatggcccaggcaaatcgacctattggc
accgtcgtgcccatgtccaatcttggcggcgatggtgcgcctccaggcgccggtggactc
gttggcaacacgcagcaacagcaacagcaactggccgcggcgaatgcgcaaatgaattcc
cagcagcagcagcagcaacagccaccaggcgtgcaacagggcgccatggggccacgtgcg
ccacagcctaaccaactcctagggcactctcagcaacagcagcaacagcagcagcccgga
acatctcaacaacagcaagcaatagcgtcaggtgtggcatcgtccgttagcgtggcagcg
ccagcgccagcgtcaagcaacatgacggacgagcgcaagaagcaaatccagcagcagctg
atgctcctgctgcacgcgcacaagtgcaacaagcgcgagaacatgaatcccaaccgcgag
gtctgcagcgtcaactattgcaaggccatgaaggccgtcctggcgcatatggccacgtgc
aagcagagcaaggactgcccaatgcagcactgcacctcgtcgcgccagatactgctccac
tacaagacctgccagcgttccgattgcatcatttgctctccctttcggcagaacaattcg
ctctttcagaatgccagcggcggtggaggcggcggtggagcggctgtagcgcccaatgcg
tcaccgctgcagcaacagcaacagcaacaacaacagcagcagcagcagcagcttccgcag
ggccagcagcaggtgccgcagaatccgtctggcgtaggagtcggagtcggaggtggtgtc
ggtgtcggagtcggagtcggtgtggacaccaaacaagtggcgcagagcgctggaacttgc
ggcgctccaaatacggcaattgtcctgccgcagcaacaagcggccggcgcgtccaacgtg
cccaagggcaacacagacatgggacagcaacaacagcagcagcagcatcagcaggtgcaa
cagcaggagctgcggcgattcgaaggagtcggcagcataggccaagtagggccggtacca
gccggcatgttgggcgcgcccggacaaggcatggcacctggaatacgaatgcaaggcgct
ccgtcggtgcgtgtgctcggcgtgcagcccggccagccaggcagtacaatggcgtccggc
ggcgtgcccgtaccagtgcctgtgcccggccagaacgtcctgcccggtgccaacgacgtc
ggcagtttgcagcagcagcagcagcaggcggcgcaagctgctcagcagagtggacagctg
atgctgcagggatgcaacactggcactggtggacgcagacgcgcgcttcaaaacatggtg
gatcagcagcagcagcccaacgcgcagcagcagagcgtacagcagcagcagcagcagcaa
ttgggcaacattccagcaccgctttccgtcaacgttggcttcaacaatgccaatttcgtt
ggcgttggcgataagcagcaacagcagcagcagcaacaacaacagcagcaacagctggtt
ggccagtcggatcagatgaccaagctgaagctgcaagcccaggcgcaggctcaggtgcag
gcgcacgtcaatgtcgtctcggctggcggtgcgccaggcagcggcaacagtgcgtctggc
ggcgcgagcgtcctgatgccggcggacacgacaggcggcgccaacagcgcgtcggctggg
tccaatgcggtgggcactggagcgggcggtgctgcgggcggcggtgcgcctggcaacggc
agtgacagcgagaaggactggcgtgagtcagtcacagcggacctgcgcaaccatctcgtg
cacaagctggtgcaggcgatatttccgacctcagatccgaccacgatgcaggacaagcgc
atgcacaatctggtcacgtacgctgagaaggtggagaaggacatgtacgagatggccaag
aaccgttctgagtactaccacctgctggccgagaagatctacaagatacagaaggagctg
gaagagaagcggctcaagcgcaaagagcagcaccagcagcagctgctccagatgcaacaa
ggtggccccaacagcagtgtcgtcaatccgacgtccgtacccaacaacgcgctgcagcag
cagcagcagccaggccagggtgtgcgtcccaatattagcccgatgggcggcggcggcggc
ggtgggggtggcccgagtggcatgatgcaacagcagatgcgtccccaggcgcctggcatg
ggcgttggcgtaggcgtcggccagcagcagcagacggcggctgggcaggcgaacatggtc
gctgtggcggcgagcatgcgtagtcactcgcccggcggcaatatgctcgccattcagcag
cagcagcgcatgcaattcccgcaacagcagcagcccggccagggcaacatgttggtcgga
ccaccgggccccagtccaggcggaatggtggcgaatccggtgctgtcgccgttcaacacg
cagcagacgatgcagtcagcgacggcggtgggcggcggcccgggcatcttaaccagccca
gtacccggtcaacagcaacagcagcaacaacagcagcagcagcagcagcagcagttcata
aatgcgaatggcagttccggcgcgcagaattctcagatcagcgagattatgaagcagcgc
ttgctgcaacatcagcagcagacgaacgcagcggccatgctattgccgcagtcgcccttc
aacaatgccacgcccattcaacagccacagcagcagcagcaacagcagcaacagcagcag
caacaacagcagcaacaacagcagcagcagcagcagcagcagcaaacaaatgccttcagt
tcacccatgcagcagaagacgcagcctcctggcagtgtgctcaacaatatgccacccacg
cccaccagcttggatgcactgaatgcgggcgcagcgagcgctggcgccggcagcattggt
ggcggtaccgtggctgcgccaagcccctcgcctagcttcatgtccaatggtcccattggc
acgccctcgaacaatccgccctctgttagcagtctgatgcagccgctgagcaatcgagca
gcaactccgccatatatacctacctcgccggtgccggcgacgagcgcttcgggcctgacg
gccagcagtacgcccgcatcggcagcagcaacatgctccagcagcggcagtggcagcagc
accagcagctcggccgtcgtcacaacgacaacggtgacgacgccgttgagctgtgcctcg
tcgtcgggcacgacgcccacatcgacgacaacgtcgacgagcggcaacggcagtgcgacg
ccggcgagcagcaccctgctgcagatggcgcgcagcaacagcgagaacagtgcaccgggc
cgggtgatgagcagctcgagcagcctgtcctcacagatggcggcactggaggcggcggcg
cgtgataatgacgatgagacgccgtcgccggctggggcgaacgatacgaacggaagtaat
ggcggcagtggcggcggaatggcatccaagggcaagctggactccatcaagcaggaggac
gacatcaagaagaagttcatggacgacagctgcggcggcaacggcgacagctcgcaaatg
gactgctccacaggcggcaagggcaagaatgtgaacaacgacggcaccagcatgctgaag
atggaaataaagacggaagtcggcgcagatgtgaagccgatcaagtcggacccaatggac
gtggatgaatcggccgtctccagtggcattgccggcggcgccaatggcgatgggacgata
ggtggcagcggcgtcgatagcaaggacgacattaatggtgctatcgatggcgtttcctcg
ggactcgcagcggacattaagctcaagtctgaaacgaagcctcatgtgcctgagcctctg
gcacccaatgctggtgacaagaagaagaaatgccaattcaacccggaagagctgcgcaca
gccctgatgcccacgctggagaagctgtaccggcaggagccggagtcggtgccatttcgt
tatccagtcgatccgcaggcgctggccatacccgactacttcgagatcgtaaagaagcca
atggacctgggcaccattcgcagcaacatactgaatggcaaatacagtgatccatgggag
tatgtggacgacgtctggctgatgttcgacaatgcgtggctctacaatcgcaagacatcg
cgcgtctatcgttactgcaccaagctgtcagaggtgttcgagcaggaaatagatcccgtg
atgcaggcgctaggctactgctgcggccgcaaatacacgttcaatccgcaggtgctctgc
tgctacggcaagcagctgtgcacgataccgcgcgacgccaaatactacagctaccaaaac
agtctaaaggaatacggtgtcgcctcaaatagatacacgttctgccaaaagtgctttaat
gacatacaaggagatactgttaccctgggcgaggatccgcagcagtcgcaaacccaaatc
aaaaaggaccaatttaaggagatgaagaacgaccacttggagctggagccattcgtggac
tgccaggagtgcggacgcaaacagcatcagatctgcgtgctttggctcgattcgatatgg
ccgggcggctttgtatgtgataactgtctgaagaagaagaattccaaacgaaaggagaac
aaattcaacgccaagcgcctgcccaccaccaagctgggcgtctacatcgagacgcgcgtg
aacaatttcctcaagaagaaggaagccagcgccggcgaggtgcacatacgtgtggtgtcc
tcctcggacaagtgcgtggaggtgaagccgggcatgcgacggcggtttgtggagggcggc
gagatgatgcaggagttcccatatcgggcgaaggccctgtttgcctttgaagaagtggat
ggcatcgacgtctgcttcttcggcatgcacgtccaggagtatgggtccgagtgtccggcg
ccaaatacgcggcgcgtctacattgcctacctcgattcggtgcacttctttcggccacgc
cagtatcgcacggcagtctaccacgagattctgctgggctacatggactatgtgaagcag
ctgggctacacgatggcgcacatttgggcgtgtccgccttctgagggcgatgactacata
tttcattgtcatccgacggatcagaaaatacccaagccgaagcgcctgcaggagtggtac
aagaagatgctggacaagggcatgattgagcgcatcatacaggactataaggacatactt
aaacaggccatggaagataagctcggctcggccgcggagctgccctactttgagggcgac
ttttggcccaatgtgctggaggagagcatcaaggagctcgaccaagaggaggaggagaag
cgcaaacaggcggaggcagccgaagcagctgccgcagctaacctcttttctattgaggat
aacgaggttagtggcgacggcaaaaagaaaggccaaaagaaggccaaaaagtcaaacaag
tccaaagcagcacagcgtaagaatagcaaaaagtcgaacgagcatcagtcgggcaacgat
ttgtccgccaagatctatgcgaccatggagaagcacaaagaagtcttctttgtcatacgc
ctacactctgcccaatcagcagcaagtctggcgccaatccaagatccggatccgttgctg
acctgtgatctgatggacggacgcgatgcattcctcacacttgcccgcgacaagcactac
gagttctcttcgctgcgacgcgctcagttctccacgctatccatgttgtacgagctgcac
aatcagggccaggacaagttcgtttacacgtgcaacaactgcaagacggcggtcgagacg
cgctaccactgcaccgtctgtgatgactttgatctctgcacggtgtgcaaggagaaggtc
ggacatccgcacaagatggagaaactgggcttcgatttggacgatggctcggcgccggcc
gatctcaaacaggcgaatccgcaggaggcgcgcaagcagtccattcagcgatgcatccaa
tccctggtgcacgcgtgccagtgtcgcgatgccaattgccgtttgccttcctgccagaag
atgaagcgcgtcgtccagcacaccaagaactgcaagcgaaaaaccaacggtggctgtccc
atatgcaagcagctcatcgccctctgctgctaccacgccaagcactgtcaggagcagaag
tgtccagtgcctttctgtcccaacatcaagcacaagctcaagcagcagcagctccagcaa
aaattgcagcagcaacagttattgcgtcgccgcgtcgctcttatgtcgagaaccgcagcg
cccgctgcgttgcccggtccagcggttagcgggccagtggtggcaagtggcgccgttggt
gtcggtggcccggtcgtgggcatgtccggcgtggcagtcagccagcaggtgatgtcgggg
caagcagccatcatgccagccggaggcggcggcatgagtccgtccacggtggcggtgccg
tcgccagtgtcgggggctgttatggccggcatgacatcgccacatccgcaccagccgggc
attggcatgaagcccggtgggcactcgccgtcgccgaatgtgctgcaagtggtgaagcag
gtgcaggaggaggcagcccgtcaacaggtgccgcacggtggaagctttggcaagggtgtg
cccatggcgccgcctgtcatgcaacggccaatgggcgtgggcgtgtcgaaccaaggcggc
atgggtggcatggtgagcaatgtgggcggcaatcagctggctggcaatgtgggcgtggtg
ccaggcggcggacagctgcccagcggcgcgaactgcaacaatattctgaacgccaacaat
ctgctgcccctggatcagtggggcggcagcggcggccccggccagcagcgctacacgaac
aacgcgcccaaccagcccggtatgcgccagcccaaccagctgatgcagcagaacatacag
cagcagcagcagcagatgatgggcatgccgcccaatcagctcggcgtcggagtaggagtc
ggagttggagccgggcagatgcccgttgtgggcagtggtgtgaacatgggcggcggtgga
gcgccccatagcattggcttgggatcgcaaattggcgccgcggcctctggcggcggtgta
cggccacccggagcccaaggcgtgggcggaggtggagctggcggtgcgggacccaacatg
ggcaatgggccgccactcaacacgcaaacactggcccatatcatgcagaagattaagaac
aatccgaccaacgagagcaaccagcacatactcaacatactgaagcagaatccccagatt
atggcggccatcataaaacagcgccagcagagccaaataaacgctgccgccggcggagct
ggtggcccacccggcgctatacaggcgggcaacggaccgcagactccgcagcagcagcaa
caacagcagcaggtgatgcagcagcagcagatgcagcatatgatgaaccaacagcaacag
ggacccggccccgggccacagcagatgggccccggccaacagcagcaagtgagcctaatg
caggccgcacagcagcagcagcagggacctccgcatcagcgcatggccaacatgcagaac
acggcaatgatgctgcccaatttgccgccaggctcacaaggaggcatggtgcccaatcag
aacttgaataaaatgcgatatatgccaatgaaccaatatccgccaccgtatccacaacgc
cagcgcggcccacacatgggcgtttttgggcagccaccgtttccgggcggtacagctggg
aactttaacgccggcggtggaggaaatgtcagcggaataccagtagcgggtgcagctgtg
ggcagcggtgcgtccgggcccggctctgaccaatactccatggcgaatgcagctgcgtcc
aacatgctgcagcagcagcaaggcggcggcggcgcaggtgtcaagcccggtccgcagcag
caacagcagcagcagcaacagcagatgggcgtcatgcctccgggcatgcagcaacagcag
cccatgcagcagcagcaacagcagcagcaaatgatgcaggttgtcgccgctggaggtggc
ggcatgagcagcacaaatccgcaaaacacgttgcctggaggcggcggcgggcccagtgga
cccggagctaatgtgatgggtccgcccacgccgcatacgctgcagcagcagcttatgcag
tcggctcgttcctctccaccaatacgctcgccacagccaacgccctcgccgcgctcggcc
ccgtcgccgcgtgggccctcagcatcgcctcgagcgcagccctcgccgcatcatgtcatg
agcagtcactcaccggcgccccaaggaccacacgacggcctgcacaatcatggcatgcac
catcagtcgccgctgccgggtgtgccccaggatgtgggcgtgagtggagtgggtgtcggt
gttggggtcggcgttggcgtcaatgccggcaatgtgggcaatgcaggtggctctctgccc
gatgcctctgaccagctgagcaagtttgtggagaggctctag

DBGET integrated database retrieval system