KEGG   Drosophila mojavensis: Dmoj_GI14627Help
Entry
Dmoj_GI14627      CDS       T01062                                 

Definition
GI14627 gene product from transcript GI14627-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dmo04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dmo04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dmo04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dmo04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3232 aa AA seqDB search
MADHLDEPPQKRVKMDQTDLYFLEDNLPDELVSSSSGWSDQLNTGGGGGGGVGGVVSTAS
GVVGAGGPNKPPTQGPGPGVVPPQMNGAGGGGDDGSGNGGSGAAGSQLRQLQHHQHLQQL
LQHQQQGNKGAGGGMVVPGMNQLGSKSPNLQSPNTAGMQVATQMGMVNSMPMSISNNGNN
GMNSIPGMNSIAQGNLGNMVLTNSGGMGTIGGAGLVNTLKQPGGASMMSTVPGSVGVSSV
TGAAPSQGMHMQNGPMMGRMVGGQQHLLRGPHLMGGGAGGGNGPGGVVGAGGGPRMQNPN
MQLGQINNMPYGVGNYGAPGSNNTQLLAQQMAQRGAGGVGGVVAPNMSAGMAQANRPIGT
VVPMSNLGGDGAPPGAGGLVGNTQQQQQQLAAANAQMNSQQQQQQQPPGVQQGAMGPRAP
QPNQLLGHSQQQQQQQQPGTSQQQQAIASGVASSVSVAAPAPASSNMTDERKKQIQQQLM
LLLHAHKCNKRENMNPNREVCSVNYCKAMKAVLAHMATCKQSKDCPMQHCTSSRQILLHY
KTCQRSDCIICSPFRQNNSLFQNASGGGGGGGAAVAPNASPLQQQQQQQQQQQQQQLPQG
QQQVPQNPSGVGVGVGGGVGVGVGVGVDTKQVAQSAGTCGAPNTAIVLPQQQAAGASNVP
KGNTDMGQQQQQQQHQQVQQQELRRFEGVGSIGQVGPVPAGMLGAPGQGMAPGIRMQGAP
SVRVLGVQPGQPGSTMASGGVPVPVPVPGQNVLPGANDVGSLQQQQQQAAQAAQQSGQLM
LQGCNTGTGGRRRALQNMVDQQQQPNAQQQSVQQQQQQQLGNIPAPLSVNVGFNNANFVG
VGDKQQQQQQQQQQQQQLVGQSDQMTKLKLQAQAQAQVQAHVNVVSAGGAPGSGNSASGG
ASVLMPADTTGGANSASAGSNAVGTGAGGAAGGGAPGNGSDSEKDWRESVTADLRNHLVH
KLVQAIFPTSDPTTMQDKRMHNLVTYAEKVEKDMYEMAKNRSEYYHLLAEKIYKIQKELE
EKRLKRKEQHQQQLLQMQQGGPNSSVVNPTSVPNNALQQQQQPGQGVRPNISPMGGGGGG
GGGPSGMMQQQMRPQAPGMGVGVGVGQQQQTAAGQANMVAVAASMRSHSPGGNMLAIQQQ
QRMQFPQQQQPGQGNMLVGPPGPSPGGMVANPVLSPFNTQQTMQSATAVGGGPGILTSPV
PGQQQQQQQQQQQQQQQFINANGSSGAQNSQISEIMKQRLLQHQQQTNAAAMLLPQSPFN
NATPIQQPQQQQQQQQQQQQQQQQQQQQQQQQQQTNAFSSPMQQKTQPPGSVLNNMPPTP
TSLDALNAGAASAGAGSIGGGTVAAPSPSPSFMSNGPIGTPSNNPPSVSSLMQPLSNRAA
TPPYIPTSPVPATSASGLTASSTPASAAATCSSSGSGSSTSSSAVVTTTTVTTPLSCASS
SGTTPTSTTTSTSGNGSATPASSTLLQMARSNSENSAPGRVMSSSSSLSSQMAALEAAAR
DNDDETPSPAGANDTNGSNGGSGGGMASKGKLDSIKQEDDIKKKFMDDSCGGNGDSSQMD
CSTGGKGKNVNNDGTSMLKMEIKTEVGADVKPIKSDPMDVDESAVSSGIAGGANGDGTIG
GSGVDSKDDINGAIDGVSSGLAADIKLKSETKPHVPEPLAPNAGDKKKKCQFNPEELRTA
LMPTLEKLYRQEPESVPFRYPVDPQALAIPDYFEIVKKPMDLGTIRSNILNGKYSDPWEY
VDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEQEIDPVMQALGYCCGRKYTFNPQVLCC
YGKQLCTIPRDAKYYSYQNSLKEYGVASNRYTFCQKCFNDIQGDTVTLGEDPQQSQTQIK
KDQFKEMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENK
FNAKRLPTTKLGVYIETRVNNFLKKKEASAGEVHIRVVSSSDKCVEVKPGMRRRFVEGGE
MMQEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQ
YRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYK
KMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKR
KQAEAAEAAAAANLFSIEDNEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDL
SAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHYE
FSSLRRAQFSTLSMLYELHNQGQDKFVYTCNNCKTAVETRYHCTVCDDFDLCTVCKEKVG
HPHKMEKLGFDLDDGSAPADLKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKM
KRVVQHTKNCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVPFCPNIKHKLKQQQLQQK
LQQQQLLRRRVALMSRTAAPAALPGPAVSGPVVASGAVGVGGPVVGMSGVAVSQQVMSGQ
AAIMPAGGGGMSPSTVAVPSPVSGAVMAGMTSPHPHQPGIGMKPGGHSPSPNVLQVVKQV
QEEAARQQVPHGGSFGKGVPMAPPVMQRPMGVGVSNQGGMGGMVSNVGGNQLAGNVGVVP
GGGQLPSGANCNNILNANNLLPLDQWGGSGGPGQQRYTNNAPNQPGMRQPNQLMQQNIQQ
QQQQMMGMPPNQLGVGVGVGVGAGQMPVVGSGVNMGGGGAPHSIGLGSQIGAAASGGGVR
PPGAQGVGGGGAGGAGPNMGNGPPLNTQTLAHIMQKIKNNPTNESNQHILNILKQNPQIM
AAIIKQRQQSQINAAAGGAGGPPGAIQAGNGPQTPQQQQQQQQVMQQQQMQHMMNQQQQG
PGPGPQQMGPGQQQQVSLMQAAQQQQQGPPHQRMANMQNTAMMLPNLPPGSQGGMVPNQN
LNKMRYMPMNQYPPPYPQRQRGPHMGVFGQPPFPGGTAGNFNAGGGGNVSGIPVAGAAVG
SGASGPGSDQYSMANAAASNMLQQQQGGGGAGVKPGPQQQQQQQQQQMGVMPPGMQQQQP
MQQQQQQQQMMQVVAAGGGGMSSTNPQNTLPGGGGGPSGPGANVMGPPTPHTLQQQLMQS
ARSSPPIRSPQPTPSPRSAPSPRGPSASPRAQPSPHHVMSSHSPAPQGPHDGLHNHGMHH
QSPLPGVPQDVGVSGVGVGVGVGVGVNAGNVGNAGGSLPDASDQLSKFVERL
NT seq 9699 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcatttggacgaaccgccacagaagcgggtcaaaatggatcaaacggatctg
tactttctggaggacaatctgcccgatgagctggtgtcctccagcagtggctggtcggat
cagctgaacactggtggcggcggcggtggcggtgttggcggcgttgtatccacagccagc
ggcgtcgttggcgctggtggaccaaacaaaccacctactcagggacctggtccaggcgtc
gtgccaccacagatgaacggagccggtggcggcggtgacgatggcagtggtaatggcggc
agtggcgctgccggcagtcaactacgtcagctacagcaccatcagcatctgcaacagttg
ctgcagcaccagcaacagggcaacaaaggcgctggcggcggcatggtggtgccgggcatg
aatcaactgggcagcaagtcgcctaacctgcaatcgcccaacacggctggcatgcaggtg
gccacacagatgggcatggtcaactcaatgcccatgtccatatcgaataatggcaacaac
ggcatgaattccataccaggcatgaacagcattgctcagggcaatctaggcaacatggtg
ctgacgaatagcggcggcatgggcaccattggaggcgccggcctagtcaacacactgaag
cagccaggcggggcatccatgatgagcactgtgcccggctcggtgggcgtgagctcggtg
accggcgcagcgcccagccagggtatgcatatgcagaatggaccgatgatggggcgcatg
gttgggggacagcagcatctgctgcgaggcccgcacttgatgggcggcggagctggcggt
ggcaatggaccgggcggcgtagtcggagccggcggcggcccccgcatgcaaaacccgaac
atgcagctgggccaaatcaacaatatgccttatggagtcggcaactatggtgcacccggc
agcaacaacacgcagctactcgcgcagcagatggcgcagcggggcgctggtggcgtcggt
ggcgttgtcgcgcccaacatgagcgccggtatggcccaggcaaatcgacctattggcacc
gtcgtgcccatgtccaatcttggcggcgatggtgcgcctccaggcgccggtggactcgtt
ggcaacacgcagcaacagcaacagcaactggccgcggcgaatgcgcaaatgaattcccag
cagcagcagcagcaacagccaccaggcgtgcaacagggcgccatggggccacgtgcgcca
cagcctaaccaactcctagggcactctcagcaacagcagcaacagcagcagcccggaaca
tctcaacaacagcaagcaatagcgtcaggtgtggcatcgtccgttagcgtggcagcgcca
gcgccagcgtcaagcaacatgacggacgagcgcaagaagcaaatccagcagcagctgatg
ctcctgctgcacgcgcacaagtgcaacaagcgcgagaacatgaatcccaaccgcgaggtc
tgcagcgtcaactattgcaaggccatgaaggccgtcctggcgcatatggccacgtgcaag
cagagcaaggactgcccaatgcagcactgcacctcgtcgcgccagatactgctccactac
aagacctgccagcgttccgattgcatcatttgctctccctttcggcagaacaattcgctc
tttcagaatgccagcggcggtggaggcggcggtggagcggctgtagcgcccaatgcgtca
ccgctgcagcaacagcaacagcaacaacaacagcagcagcagcagcagcttccgcagggc
cagcagcaggtgccgcagaatccgtctggcgtaggagtcggagtcggaggtggtgtcggt
gtcggagtcggagtcggtgtggacaccaaacaagtggcgcagagcgctggaacttgcggc
gctccaaatacggcaattgtcctgccgcagcaacaagcggccggcgcgtccaacgtgccc
aagggcaacacagacatgggacagcaacaacagcagcagcagcatcagcaggtgcaacag
caggagctgcggcgattcgaaggagtcggcagcataggccaagtagggccggtaccagcc
ggcatgttgggcgcgcccggacaaggcatggcacctggaatacgaatgcaaggcgctccg
tcggtgcgtgtgctcggcgtgcagcccggccagccaggcagtacaatggcgtccggcggc
gtgcccgtaccagtgcctgtgcccggccagaacgtcctgcccggtgccaacgacgtcggc
agtttgcagcagcagcagcagcaggcggcgcaagctgctcagcagagtggacagctgatg
ctgcagggatgcaacactggcactggtggacgcagacgcgcgcttcaaaacatggtggat
cagcagcagcagcccaacgcgcagcagcagagcgtacagcagcagcagcagcagcaattg
ggcaacattccagcaccgctttccgtcaacgttggcttcaacaatgccaatttcgttggc
gttggcgataagcagcaacagcagcagcagcaacaacaacagcagcaacagctggttggc
cagtcggatcagatgaccaagctgaagctgcaagcccaggcgcaggctcaggtgcaggcg
cacgtcaatgtcgtctcggctggcggtgcgccaggcagcggcaacagtgcgtctggcggc
gcgagcgtcctgatgccggcggacacgacaggcggcgccaacagcgcgtcggctgggtcc
aatgcggtgggcactggagcgggcggtgctgcgggcggcggtgcgcctggcaacggcagt
gacagcgagaaggactggcgtgagtcagtcacagcggacctgcgcaaccatctcgtgcac
aagctggtgcaggcgatatttccgacctcagatccgaccacgatgcaggacaagcgcatg
cacaatctggtcacgtacgctgagaaggtggagaaggacatgtacgagatggccaagaac
cgttctgagtactaccacctgctggccgagaagatctacaagatacagaaggagctggaa
gagaagcggctcaagcgcaaagagcagcaccagcagcagctgctccagatgcaacaaggt
ggccccaacagcagtgtcgtcaatccgacgtccgtacccaacaacgcgctgcagcagcag
cagcagccaggccagggtgtgcgtcccaatattagcccgatgggcggcggcggcggcggt
gggggtggcccgagtggcatgatgcaacagcagatgcgtccccaggcgcctggcatgggc
gttggcgtaggcgtcggccagcagcagcagacggcggctgggcaggcgaacatggtcgct
gtggcggcgagcatgcgtagtcactcgcccggcggcaatatgctcgccattcagcagcag
cagcgcatgcaattcccgcaacagcagcagcccggccagggcaacatgttggtcggacca
ccgggccccagtccaggcggaatggtggcgaatccggtgctgtcgccgttcaacacgcag
cagacgatgcagtcagcgacggcggtgggcggcggcccgggcatcttaaccagcccagta
cccggtcaacagcaacagcagcaacaacagcagcagcagcagcagcagcagttcataaat
gcgaatggcagttccggcgcgcagaattctcagatcagcgagattatgaagcagcgcttg
ctgcaacatcagcagcagacgaacgcagcggccatgctattgccgcagtcgcccttcaac
aatgccacgcccattcaacagccacagcagcagcagcaacagcagcaacagcagcagcaa
caacagcagcaacaacagcagcagcagcagcagcagcagcaaacaaatgccttcagttca
cccatgcagcagaagacgcagcctcctggcagtgtgctcaacaatatgccacccacgccc
accagcttggatgcactgaatgcgggcgcagcgagcgctggcgccggcagcattggtggc
ggtaccgtggctgcgccaagcccctcgcctagcttcatgtccaatggtcccattggcacg
ccctcgaacaatccgccctctgttagcagtctgatgcagccgctgagcaatcgagcagca
actccgccatatatacctacctcgccggtgccggcgacgagcgcttcgggcctgacggcc
agcagtacgcccgcatcggcagcagcaacatgctccagcagcggcagtggcagcagcacc
agcagctcggccgtcgtcacaacgacaacggtgacgacgccgttgagctgtgcctcgtcg
tcgggcacgacgcccacatcgacgacaacgtcgacgagcggcaacggcagtgcgacgccg
gcgagcagcaccctgctgcagatggcgcgcagcaacagcgagaacagtgcaccgggccgg
gtgatgagcagctcgagcagcctgtcctcacagatggcggcactggaggcggcggcgcgt
gataatgacgatgagacgccgtcgccggctggggcgaacgatacgaacggaagtaatggc
ggcagtggcggcggaatggcatccaagggcaagctggactccatcaagcaggaggacgac
atcaagaagaagttcatggacgacagctgcggcggcaacggcgacagctcgcaaatggac
tgctccacaggcggcaagggcaagaatgtgaacaacgacggcaccagcatgctgaagatg
gaaataaagacggaagtcggcgcagatgtgaagccgatcaagtcggacccaatggacgtg
gatgaatcggccgtctccagtggcattgccggcggcgccaatggcgatgggacgataggt
ggcagcggcgtcgatagcaaggacgacattaatggtgctatcgatggcgtttcctcggga
ctcgcagcggacattaagctcaagtctgaaacgaagcctcatgtgcctgagcctctggca
cccaatgctggtgacaagaagaagaaatgccaattcaacccggaagagctgcgcacagcc
ctgatgcccacgctggagaagctgtaccggcaggagccggagtcggtgccatttcgttat
ccagtcgatccgcaggcgctggccatacccgactacttcgagatcgtaaagaagccaatg
gacctgggcaccattcgcagcaacatactgaatggcaaatacagtgatccatgggagtat
gtggacgacgtctggctgatgttcgacaatgcgtggctctacaatcgcaagacatcgcgc
gtctatcgttactgcaccaagctgtcagaggtgttcgagcaggaaatagatcccgtgatg
caggcgctaggctactgctgcggccgcaaatacacgttcaatccgcaggtgctctgctgc
tacggcaagcagctgtgcacgataccgcgcgacgccaaatactacagctaccaaaacagt
ctaaaggaatacggtgtcgcctcaaatagatacacgttctgccaaaagtgctttaatgac
atacaaggagatactgttaccctgggcgaggatccgcagcagtcgcaaacccaaatcaaa
aaggaccaatttaaggagatgaagaacgaccacttggagctggagccattcgtggactgc
caggagtgcggacgcaaacagcatcagatctgcgtgctttggctcgattcgatatggccg
ggcggctttgtatgtgataactgtctgaagaagaagaattccaaacgaaaggagaacaaa
ttcaacgccaagcgcctgcccaccaccaagctgggcgtctacatcgagacgcgcgtgaac
aatttcctcaagaagaaggaagccagcgccggcgaggtgcacatacgtgtggtgtcctcc
tcggacaagtgcgtggaggtgaagccgggcatgcgacggcggtttgtggagggcggcgag
atgatgcaggagttcccatatcgggcgaaggccctgtttgcctttgaagaagtggatggc
atcgacgtctgcttcttcggcatgcacgtccaggagtatgggtccgagtgtccggcgcca
aatacgcggcgcgtctacattgcctacctcgattcggtgcacttctttcggccacgccag
tatcgcacggcagtctaccacgagattctgctgggctacatggactatgtgaagcagctg
ggctacacgatggcgcacatttgggcgtgtccgccttctgagggcgatgactacatattt
cattgtcatccgacggatcagaaaatacccaagccgaagcgcctgcaggagtggtacaag
aagatgctggacaagggcatgattgagcgcatcatacaggactataaggacatacttaaa
caggccatggaagataagctcggctcggccgcggagctgccctactttgagggcgacttt
tggcccaatgtgctggaggagagcatcaaggagctcgaccaagaggaggaggagaagcgc
aaacaggcggaggcagccgaagcagctgccgcagctaacctcttttctattgaggataac
gaggttagtggcgacggcaaaaagaaaggccaaaagaaggccaaaaagtcaaacaagtcc
aaagcagcacagcgtaagaatagcaaaaagtcgaacgagcatcagtcgggcaacgatttg
tccgccaagatctatgcgaccatggagaagcacaaagaagtcttctttgtcatacgccta
cactctgcccaatcagcagcaagtctggcgccaatccaagatccggatccgttgctgacc
tgtgatctgatggacggacgcgatgcattcctcacacttgcccgcgacaagcactacgag
ttctcttcgctgcgacgcgctcagttctccacgctatccatgttgtacgagctgcacaat
cagggccaggacaagttcgtttacacgtgcaacaactgcaagacggcggtcgagacgcgc
taccactgcaccgtctgtgatgactttgatctctgcacggtgtgcaaggagaaggtcgga
catccgcacaagatggagaaactgggcttcgatttggacgatggctcggcgccggccgat
ctcaaacaggcgaatccgcaggaggcgcgcaagcagtccattcagcgatgcatccaatcc
ctggtgcacgcgtgccagtgtcgcgatgccaattgccgtttgccttcctgccagaagatg
aagcgcgtcgtccagcacaccaagaactgcaagcgaaaaaccaacggtggctgtcccata
tgcaagcagctcatcgccctctgctgctaccacgccaagcactgtcaggagcagaagtgt
ccagtgcctttctgtcccaacatcaagcacaagctcaagcagcagcagctccagcaaaaa
ttgcagcagcaacagttattgcgtcgccgcgtcgctcttatgtcgagaaccgcagcgccc
gctgcgttgcccggtccagcggttagcgggccagtggtggcaagtggcgccgttggtgtc
ggtggcccggtcgtgggcatgtccggcgtggcagtcagccagcaggtgatgtcggggcaa
gcagccatcatgccagccggaggcggcggcatgagtccgtccacggtggcggtgccgtcg
ccagtgtcgggggctgttatggccggcatgacatcgccacatccgcaccagccgggcatt
ggcatgaagcccggtgggcactcgccgtcgccgaatgtgctgcaagtggtgaagcaggtg
caggaggaggcagcccgtcaacaggtgccgcacggtggaagctttggcaagggtgtgccc
atggcgccgcctgtcatgcaacggccaatgggcgtgggcgtgtcgaaccaaggcggcatg
ggtggcatggtgagcaatgtgggcggcaatcagctggctggcaatgtgggcgtggtgcca
ggcggcggacagctgcccagcggcgcgaactgcaacaatattctgaacgccaacaatctg
ctgcccctggatcagtggggcggcagcggcggccccggccagcagcgctacacgaacaac
gcgcccaaccagcccggtatgcgccagcccaaccagctgatgcagcagaacatacagcag
cagcagcagcagatgatgggcatgccgcccaatcagctcggcgtcggagtaggagtcgga
gttggagccgggcagatgcccgttgtgggcagtggtgtgaacatgggcggcggtggagcg
ccccatagcattggcttgggatcgcaaattggcgccgcggcctctggcggcggtgtacgg
ccacccggagcccaaggcgtgggcggaggtggagctggcggtgcgggacccaacatgggc
aatgggccgccactcaacacgcaaacactggcccatatcatgcagaagattaagaacaat
ccgaccaacgagagcaaccagcacatactcaacatactgaagcagaatccccagattatg
gcggccatcataaaacagcgccagcagagccaaataaacgctgccgccggcggagctggt
ggcccacccggcgctatacaggcgggcaacggaccgcagactccgcagcagcagcaacaa
cagcagcaggtgatgcagcagcagcagatgcagcatatgatgaaccaacagcaacaggga
cccggccccgggccacagcagatgggccccggccaacagcagcaagtgagcctaatgcag
gccgcacagcagcagcagcagggacctccgcatcagcgcatggccaacatgcagaacacg
gcaatgatgctgcccaatttgccgccaggctcacaaggaggcatggtgcccaatcagaac
ttgaataaaatgcgatatatgccaatgaaccaatatccgccaccgtatccacaacgccag
cgcggcccacacatgggcgtttttgggcagccaccgtttccgggcggtacagctgggaac
tttaacgccggcggtggaggaaatgtcagcggaataccagtagcgggtgcagctgtgggc
agcggtgcgtccgggcccggctctgaccaatactccatggcgaatgcagctgcgtccaac
atgctgcagcagcagcaaggcggcggcggcgcaggtgtcaagcccggtccgcagcagcaa
cagcagcagcagcaacagcagatgggcgtcatgcctccgggcatgcagcaacagcagccc
atgcagcagcagcaacagcagcagcaaatgatgcaggttgtcgccgctggaggtggcggc
atgagcagcacaaatccgcaaaacacgttgcctggaggcggcggcgggcccagtggaccc
ggagctaatgtgatgggtccgcccacgccgcatacgctgcagcagcagcttatgcagtcg
gctcgttcctctccaccaatacgctcgccacagccaacgccctcgccgcgctcggccccg
tcgccgcgtgggccctcagcatcgcctcgagcgcagccctcgccgcatcatgtcatgagc
agtcactcaccggcgccccaaggaccacacgacggcctgcacaatcatggcatgcaccat
cagtcgccgctgccgggtgtgccccaggatgtgggcgtgagtggagtgggtgtcggtgtt
ggggtcggcgttggcgtcaatgccggcaatgtgggcaatgcaggtggctctctgcccgat
gcctctgaccagctgagcaagtttgtggagaggctctag

DBGET integrated database retrieval system