KEGG   Drosophila mojavensis: Dmoj_GI14693Help
Entry
Dmoj_GI14693      CDS       T01062                                 

Definition
GI14693 gene product from transcript GI14693-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dmo  Drosophila mojavensis
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dmo00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 428 aa AA seqDB search
MSTTTTTIDGYKLGKVLIEGKTKQVYNLPEHPGLCLLLSKDRITAGDGVKAHDLAGKAQI
SNTTNGQVFRLLNEAGVRTAYVKQCGEKAFIARRCEMIPIEWVTRRLATGSFLKRNVGVP
EGYRFSPPKQETFFKDDANHDPQWSDEQIISAKFELNGLTIGQDEVDIMRRTTLLVFEIL
ERAWQTKNCALIDMKVEFGVDDDGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLTSV
TSTDLDTVKRNFIWVSEQLADIVPRKDHLVVILMGSASDTSHSEKIASSCRSLGLNVELR
VSSAHKAPEETLRIVREYESVMTNLIFVAVAGRSNGLGPVLSGSTNYPVINCPPVKSDNM
QVDAWSSLNLPSGLGCATVLYPEAAALHAATILGLSNFMIWSKLRVKQLNNFVTLKKADK
ELRGVRNV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccacaacgacaacgattgacggctacaagctgggcaaggtgcttatcgagggc
aaaacgaagcaggtctacaatctgcccgagcatcctggcctctgtctgctgctcagcaag
gatcgtatcaccgccggcgatggcgtcaaggcccacgatctggctggcaaggcgcagatc
tccaacacgaccaatggccaggtatttcgcctgctcaacgaggccggcgttcgcactgca
tatgttaagcagtgcggcgagaaggcgttcattgcccgcagatgcgaaatgattccaatc
gagtgggttacgcgccgcctggcaaccggctcctttctcaagcgcaatgtgggcgtgccc
gagggctacagattctcgccccctaagcaggagacgttcttcaaggacgacgccaatcac
gatccccagtggagcgatgagcaaatcatttcggccaaattcgagctaaacggtttaaca
attggtcaggatgaggtggacattatgcgacgcaccacgctgctcgtcttcgagatcttg
gagcgtgcctggcagacgaagaactgtgcgctcatcgatatgaaggtggagttcggtgtg
gatgacgatggcaacattgtactggccgatatcatagactcggattcgtggcggctttgg
ccagcgggcgacaagcgtctgatggtcgacaagcaggtatatcgcaacctgacatcggtc
accagcaccgatctggacacggtgaagcgcaacttcatctgggtgtctgagcaattggcc
gatatcgtgccccgcaaggatcacttggttgtcatcctgatgggcagcgcttcggataca
tcgcacagcgagaagattgccagtagctgccgctcgctcggcctcaacgtggagctgcgc
gtcagctcggcccacaaggccccggaggagactctgcgcattgtccgtgaatacgaatcg
gtgatgacgaatctgatctttgtggccgtcgccggtcgctccaatggcctgggccccgtc
ctctccggcagcaccaactatccggtgatcaactgtccacccgtcaagtcggacaatatg
caggtggacgcctggtcgagcctgaatctgccgtcgggcctgggctgtgccactgtgctc
tatccggaggcagcggcgctgcacgcggccaccattctgggcctcagcaactttatgatc
tggtccaagctgcgcgtgaagcagctcaacaatttcgtgaccctaaagaaggccgacaag
gagctgcgcggcgtgcgcaatgtttga

DBGET integrated database retrieval system