KEGG   Drosophila mojavensis: Dmoj_GI14721Help
Entry
Dmoj_GI14721      CDS       T01062                                 

Definition
(RefSeq) GI14721 gene product from transcript GI14721-RA (EC:2.3.1.-)
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI14721
Chromosome [BR:dmo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dmoj_GI14721
   HAT complexes
    NSL complex
     Dmoj_GI14721
    MSL complex
     Dmoj_GI14721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 923 aa AA seqDB search
MSDEDFKRPIYRGEVAEGERTYAMVDRRPSTPVEDAEAELKENLNISGSTDPSDPDDSEA
YRSHDTSSTPEPDSTAEPPDLDTSITSQTSLDEEHIEQPVMGEQQSLREESSSSSSSSSS
SPSDSNTSPSEGSDDTTEDEPSPTTVVDVSDLTGNDDFSNCGTTENAENVAETVPAPVDA
PVDSGIEPISPVSEETEVETQAEVQTLAQVQEIPTEEAMVIETPPEPEPGPEPEPELPPE
QHQQQEPEVVEEQNMEMETEGPASPTSPASPTSPASPTEMPETPASPTDDCDEGIDLLPP
YKRAHYGVDQPIRCQQSQEHHVDLSMPIPQQQLHMQQMRLAPRDPRQKPFLLQAQFEAIS
SSSDEANSVGDEEEEDEEDDESDDNSEEGDTESNDSDVMIIEQDTDTTSGETATATEATD
ADADADGDGDEDDDDEEDNDDDDEDGGERDGNGGGDQLLLNKIDIADNPEKIYYIRRADG
TVHAGQVLQSRVTDNCVSPNEYYVHYVGLNRRLDEWVGRHRISDNPDDLGGITVTPVQPE
PLNCDQPSTSANAIAMANATNQQGAGVVRPKRQGHKDYYLSACENNRYDYSDRKMTRYQK
RRYDEINHVQKSHAELTASQAALEKEHEFITKIKYIDKLQFGNYEIDTWYFSPYPGEYGK
ARVLYVCEYCLKYMRLEKSYRYHLYTCQVRRPPGKEIYRKNTISIFEVNGKEQPLYCQLL
CLMAKLFLDHKVLYFDMDPFYFYVLCETDKRGCHIVGYFSKEKKSMDNNNVACILVLPPH
QRKGYGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKGRCSAEQTT
IKELSEASGITHDDIIYTLQSMKMIKYWKGQNVICVTAKTINDHLQLPQFKRPKLTIDLN
CLNWKPHPQPPPFGESWRNVRLQ
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaggactttaagagaccaatatatagaggggaagtggccgaaggggagaga
acttatgcaatggtcgacagacgaccgtccacgccggtagaagatgcggaagccgaactt
aaagaaaatctaaacatcagtggctccacggatccttcagacccagatgacagcgaggcc
taccgatcgcatgatacaagtagcacaccagagcccgacagtacagcagagccaccagat
ctggacacatctataacatctcaaacgtccctagacgaggagcacattgaacagccagtc
atgggcgaacagcagagcttaagagaggagagcagcagctcaagtagctctagcagcagc
agtccgagtgattcaaacacatcaccatcggagggtagcgatgataccactgaggacgag
ccctcacccaccacagtggtcgatgtcagcgatttaaccggcaacgacgacttcagcaat
tgtggtacaactgagaatgcggaaaacgttgcagaaactgttccggcaccagttgatgca
ccagttgactcaggaattgagccaatttcaccagtgtcagaggaaactgaggtcgagacg
caagcagaagtccaaactctagctcaagtgcaagaaattccaacggaagaggccatggtg
attgagactccaccggaaccagaaccaggacctgaaccggaacctgaactgccgccggaa
cagcatcaacaacaggagccagaggtcgtagaggagcaaaatatggaaatggaaactgaa
ggaccagcttcaccgacttcaccagcatcaccaacttccccagcatcaccaactgaaatg
cccgaaacaccggcgtcgcccactgacgattgtgatgagggtattgatctgctcccgccc
tataagcgcgcgcactacggagtcgatcagccgatccgatgccaacagtcacaggagcat
catgtcgacctgagtatgcccattccacaacagcaacttcacatgcagcagatgcgcttg
gcgccgcgggatcctcgtcagaagccgtttttactacaagctcaatttgaagccatctcg
agcagcagcgacgaggcgaacagtgtaggcgacgaagaggaggaagatgaggaagacgac
gagtctgatgataattcagaggaaggtgacactgagtccaatgactcggatgtgatgata
atagaacaggacacggacaccacatctggagagacggctaccgcaacagaggcaaccgat
gcagatgccgatgctgatggtgatggtgatgaggatgatgatgacgaggaggataatgac
gatgacgatgaggatggcggcgagcgtgatggcaatggtggtggagaccaattattgctg
aacaaaatcgacatagccgacaatccagagaagatctactacatacgccgcgcagatggc
accgtccacgctggccaagtgctgcagtcgcgcgtcactgacaactgcgtcagcccgaac
gagtattacgtgcactatgtgggcctgaaccgtcgactcgacgagtgggtgggccgccat
cgcatctccgacaatcctgatgatttgggcggcatcacggtcacgcccgtccagcccgag
ccactgaactgcgatcagccgagcaccagcgccaacgccattgcaatggccaacgcaacg
aaccagcagggcgcaggcgtggtgcgacccaagcgacaaggccacaaggactactatctg
tcggcatgtgagaacaaccgatacgactacagtgaccgcaagatgacgcgctatcagaag
cgacgctacgacgagatcaaccatgtccagaagagccacgctgagttaaccgcctcgcag
gcggcgctagagaaggagcacgagttcatcaccaagatcaagtatatcgacaagctccag
ttcggcaactacgagatcgacacctggtacttcagtccctatccgggtgaatatggaaag
gcgcgggtgctgtacgtctgcgagtattgcctgaagtatatgcggctggagaagagctac
cgataccacttgtacacgtgccaggtgcgcaggccaccgggcaaggaaatctatcgcaag
aacaccatctccatattcgaggtgaacggcaaggagcagccgctctactgccagctgctc
tgtttgatggctaagctgttcctcgaccataaagtactgtacttcgacatggacccattc
tacttctatgtgctttgcgagactgataagcggggctgtcacattgtgggctacttttcc
aaggagaagaagtcgatggacaacaataatgtggcctgcatcttggtgctgccaccgcac
cagcgcaagggctatggcaaactgctgattgccttcagctacgagctgtcccgcaaggag
ggcgtcattggcagcccagagaagccgctgtcggatctgggcaggctcagctatcgcagc
tattgggcctacacgctgctcgaactgatgaagggccgctgctcagcggagcagacgacc
atcaaagagctaagcgaggcgagcggcattacgcatgacgacatcatctatactctgcaa
tccatgaagatgatcaaatactggaaggggcagaacgtgatctgtgtgaccgccaaaaca
atcaacgatcatctgcagctgccgcagtttaagcgcccaaagcttaccatcgacttgaat
tgcctcaactggaaaccgcatccgcagccaccaccgtttggagaatcctggcgtaacgtc
cggctccaatga

DBGET integrated database retrieval system