KEGG   Drosophila mojavensis: Dmoj_GI14721Help
Entry
Dmoj_GI14721      CDS       T01062                                 

Definition
GI14721 gene product from transcript GI14721-RA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 900 aa AA seqDB search
MVDRRPSTPVEDAEAELKENLNISGSTDPSDPDDSEAYRSHDTSSTPEPDSTAEPPDLDT
SITSQTSLDEEHIEQPVMGEQQSLREESSSSSSSSSSSPSDSNTSPSEGSDDTTEDEPSP
TTVVDVSDLTGNDDFSNCGTTENAENVAETVPAPVDAPVDSGIEPISPVSEETEVETQAE
VQTLAQVQEIPTEEAMVIETPPEPEPGPEPEPELPPEQHQQQEPEVVEEQNMEMETEGPA
SPTSPASPTSPASPTEMPETPASPTDDCDEGIDLLPPYKRAHYGVDQPIRCQQSQEHHVD
LSMPIPQQQLHMQQMRLAPRDPRQKPFLLQAQFEAISSSSDEANSVGDEEEEDEEDDESD
DNSEEGDTESNDSDVMIIEQDTDTTSGETATATEATDADADADGDGDEDDDDEEDNDDDD
EDGGERDGNGGGDQLLLNKIDIADNPEKIYYIRRADGTVHAGQVLQSRVTDNCVSPNEYY
VHYVGLNRRLDEWVGRHRISDNPDDLGGITVTPVQPEPLNCDQPSTSANAIAMANATNQQ
GAGVVRPKRQGHKDYYLSACENNRYDYSDRKMTRYQKRRYDEINHVQKSHAELTASQAAL
EKEHEFITKIKYIDKLQFGNYEIDTWYFSPYPGEYGKARVLYVCEYCLKYMRLEKSYRYH
LYTCQVRRPPGKEIYRKNTISIFEVNGKEQPLYCQLLCLMAKLFLDHKVLYFDMDPFYFY
VLCETDKRGCHIVGYFSKEKKSMDNNNVACILVLPPHQRKGYGKLLIAFSYELSRKEGVI
GSPEKPLSDLGRLSYRSYWAYTLLELMKGRCSAEQTTIKELSEASGITHDDIIYTLQSMK
MIKYWKGQNVICVTAKTINDHLQLPQFKRPKLTIDLNCLNWKPHPQPPPFGESWRNVRLQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacagacgaccgtccacgccggtagaagatgcggaagccgaacttaaagaaaat
ctaaacatcagtggctccacggatccttcagacccagatgacagcgaggcctaccgatcg
catgatacaagtagcacaccagagcccgacagtacagcagagccaccagatctggacaca
tctataacatctcaaacgtccctagacgaggagcacattgaacagccagtcatgggcgaa
cagcagagcttaagagaggagagcagcagctcaagtagctctagcagcagcagtccgagt
gattcaaacacatcaccatcggagggtagcgatgataccactgaggacgagccctcaccc
accacagtggtcgatgtcagcgatttaaccggcaacgacgacttcagcaattgtggtaca
actgagaatgcggaaaacgttgcagaaactgttccggcaccagttgatgcaccagttgac
tcaggaattgagccaatttcaccagtgtcagaggaaactgaggtcgagacgcaagcagaa
gtccaaactctagctcaagtgcaagaaattccaacggaagaggccatggtgattgagact
ccaccggaaccagaaccaggacctgaaccggaacctgaactgccgccggaacagcatcaa
caacaggagccagaggtcgtagaggagcaaaatatggaaatggaaactgaaggaccagct
tcaccgacttcaccagcatcaccaacttccccagcatcaccaactgaaatgcccgaaaca
ccggcgtcgcccactgacgattgtgatgagggtattgatctgctcccgccctataagcgc
gcgcactacggagtcgatcagccgatccgatgccaacagtcacaggagcatcatgtcgac
ctgagtatgcccattccacaacagcaacttcacatgcagcagatgcgcttggcgccgcgg
gatcctcgtcagaagccgtttttactacaagctcaatttgaagccatctcgagcagcagc
gacgaggcgaacagtgtaggcgacgaagaggaggaagatgaggaagacgacgagtctgat
gataattcagaggaaggtgacactgagtccaatgactcggatgtgatgataatagaacag
gacacggacaccacatctggagagacggctaccgcaacagaggcaaccgatgcagatgcc
gatgctgatggtgatggtgatgaggatgatgatgacgaggaggataatgacgatgacgat
gaggatggcggcgagcgtgatggcaatggtggtggagaccaattattgctgaacaaaatc
gacatagccgacaatccagagaagatctactacatacgccgcgcagatggcaccgtccac
gctggccaagtgctgcagtcgcgcgtcactgacaactgcgtcagcccgaacgagtattac
gtgcactatgtgggcctgaaccgtcgactcgacgagtgggtgggccgccatcgcatctcc
gacaatcctgatgatttgggcggcatcacggtcacgcccgtccagcccgagccactgaac
tgcgatcagccgagcaccagcgccaacgccattgcaatggccaacgcaacgaaccagcag
ggcgcaggcgtggtgcgacccaagcgacaaggccacaaggactactatctgtcggcatgt
gagaacaaccgatacgactacagtgaccgcaagatgacgcgctatcagaagcgacgctac
gacgagatcaaccatgtccagaagagccacgctgagttaaccgcctcgcaggcggcgcta
gagaaggagcacgagttcatcaccaagatcaagtatatcgacaagctccagttcggcaac
tacgagatcgacacctggtacttcagtccctatccgggtgaatatggaaaggcgcgggtg
ctgtacgtctgcgagtattgcctgaagtatatgcggctggagaagagctaccgataccac
ttgtacacgtgccaggtgcgcaggccaccgggcaaggaaatctatcgcaagaacaccatc
tccatattcgaggtgaacggcaaggagcagccgctctactgccagctgctctgtttgatg
gctaagctgttcctcgaccataaagtactgtacttcgacatggacccattctacttctat
gtgctttgcgagactgataagcggggctgtcacattgtgggctacttttccaaggagaag
aagtcgatggacaacaataatgtggcctgcatcttggtgctgccaccgcaccagcgcaag
ggctatggcaaactgctgattgccttcagctacgagctgtcccgcaaggagggcgtcatt
ggcagcccagagaagccgctgtcggatctgggcaggctcagctatcgcagctattgggcc
tacacgctgctcgaactgatgaagggccgctgctcagcggagcagacgaccatcaaagag
ctaagcgaggcgagcggcattacgcatgacgacatcatctatactctgcaatccatgaag
atgatcaaatactggaaggggcagaacgtgatctgtgtgaccgccaaaacaatcaacgat
catctgcagctgccgcagtttaagcgcccaaagcttaccatcgacttgaattgcctcaac
tggaaaccgcatccgcagccaccaccgtttggagaatcctggcgtaacgtccggctccaa
tga

DBGET integrated database retrieval system