KEGG   Drosophila mojavensis: Dmoj_GI14823Help
Entry
Dmoj_GI14823      CDS       T01062                                 

Definition
GI14823 gene product from transcript GI14823-RA
Orthology
K04646  
clathrin heavy chain
Organism
dmo  Drosophila mojavensis
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dmoj_GI14823
   04142 Lysosome
    Dmoj_GI14823
Exosome [BR:dmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmoj_GI14823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1680 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINPNSFSFSTLTMESDKFICVREKTNDTAQVVIIDMNDSSN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVYHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIEGNKEPTTLFCFAVRTATGGKLHIIEVGTPPNGN
QPFPKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFGAGQYAEAAKVAALAPKGILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKTSDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLLSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSEANPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYMD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGDRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFEELIALLESALGLERAHMGMFSE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKATEFYLEYKPLLLNDMLLVLAPRMDHTRAVNYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDTIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESGKQEIAEELLGWFLE
RNAHDCFAACLYQCYDLLRPDVILELAWKHKIMDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDTTEHKNIIQMEPQLMITAGPAMGIPQQYAPNYPPVAAAAAAAAAAGRNMGYQYM
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgttacccatacgctttcaagagcatttacagctcacaaatgtcggcatc
aatccgaactccttctcattcagcacgctcacaatggagtcggataagttcatctgtgtg
cgggagaagacgaacgataccgcccaggtggtcatcattgatatgaacgactcatcgaat
ccgacgcgccgtcccatatccgcggactcggccattatgaatccggctagcaaggtgatt
gcgctcaaagcgcaaaagacattgcagatcttcaacattgagatgaagtcgaaaatgaag
gcgcacacgatgaacgaggatgtggtattctggaaatggatatcgctgaatacgctcgcc
ctggtcaccgagacgagcgtctatcactggtcgatggagggcgattcgatgccacagaaa
atgttcgataggcactcctcgctcaatggctgtcagatcatcaattatcgttgcaatgcc
tcccagcagtggctgctgctcgttggcatctcggcgctgcccagccgtgtcgctggcgcc
atgcaactgtattcggtggagcgcaaggtgtcgcaagcgattgagggacatgccgccagt
tttgccaccttcaagatcgagggcaacaaggagccgaccacgctgttctgtttcgccgtg
cgcaccgcaaccggtggcaagctgcacatcattgaggtgggaacgccaccgaatggcaat
cagccattcccgaagaaggcggtcgatgtcttctttccgccggaggcacaaaatgatttt
ccggttgcgatgcaagtatccgccaaatacgataccatctatttgataaccaaatatgga
tatatccatttgtacgatatggaaacggccacgtgcatctacatgaatcgcatatcggcc
gatacgatttttgtgaccgcaccgcacgaggccagcggcggcatcattggcgtcaatcgc
aagggccaggtgctgtccgtgaccgtcgacgaggaacagatcataccctacatcaatacg
gtgctccagaatcccgatctcgccctgcgcatggccgtgcgcaacaatttggctggcgct
gaggatctgtttgtgcgcaaattcaataagctctttggcgctggccaatacgccgaggcg
gccaaggtggctgcattggccccaaaaggtattctacgcacaccgcagaccattcaacgt
ttccagcaggtgcaaacgccagccggttcgacaacaccgccgctcttgcagtactttggc
atcctgctcgatcagggtaaactgaataagttcgagtctttggagctctgccgtcccgtg
ctcctgcagggcaagaagcagctctgcgagaagtggctgaaggaggagaagctcgagtgc
agcgaggagctgggtgacttggtgaagacatcggatctaacgctcgctctctccatctat
ctgcgcgccaatgtgcccaacaaggtgatccaatgctttgccgaaacgggccaattccag
aagatcgtgctctatgccaagaaggtcaactacacgcccgactatatattcctgttgcgt
tcggtgatgcgcagcaatccggagcagggcgccggctttgcctccatgctggtggccgaa
gaggaaccgctggccgacatcaatcagatcgtggacatctttatggagcattcgatggtg
cagcaatgcaccgcctttctgctggatgccctcaagcataatcgtcccgccgagggagca
ctgcagacgcgtctgctcgaaatgaatctgttgtcggcaccgcaggtggctgatgccatt
ctgggcaacgccatgttcacccactacgatcgcgcccatatcgcccagctgtgcgagaag
gccggcctgctgcagcgcgccctggaacactatacggatctgtatgacatcaagcgcgcc
gttgtccatacgcatatgctaaatgccgagtggctggtcagtttctttggcacactctcg
gtggaggattcactggagtgcctgaaggccatgctcaccgctaatctgcgccagaatttg
cagatttgtgtgcagatcgccaccaagtatcacgagcaattgaccaccaaggcgctgatt
gatctatttgagagcttcaagagctacgatggcctgttctattttctgagcagcattgtg
aacttctcgcaggatccggaggtgcacttcaagtacatacaggcggcctgtaaaaccaat
cagatcaaggaggtggagcgcatatgtcgcgaatcgaattgctataatcccgagcgtgtc
aagaacttcctgaaggaggccaagctgactgatcaattgcccctgattattgtctgcgat
cgtttcgatttcgtgcacgatctggtgctctatctgtaccgcaacaatctccagaaatat
attgagatctatgtgcagaaggtgaatccatcacgtttgccggttgtggtgggcggtctg
ctcgatgtcgattgcagtgaggatatcatcaagaacctaattctcgtcgttaagggtcag
ttctccacggatgagctagtggaggaggtggagaagcgtaatcgcttgaaactgctgttg
ccctggctggagtcgcgcgtccatgagggctgcgttgagccggccacccacaatgccctg
gccaagatctacattgactcgaacaacaatccggagcgattcctcaaggagaatcaatac
tacgacagccgcgtcgtcggacgttactgtgagaagcgtgatccgcacttggcctgcgtt
gcctatgaacggggtcaatgcgatcgtgaactgatcgccgtttgcaatgagaattcgctg
ttcaagagcgaggcacgctatctggttggccgtcgcgatgctgagctgtgggccgaggtg
ctgtcggaggcaaatccctacaagcgtcaactgatcgatcaggtggtgcagacagcgctg
tcggagacacaggatcccgatgatatctccgttacggtcaaggcattcatgaccgccgat
ttgcccaatgagctgatcgaattgctcgagaagatcatcttggactcgtccgtcttcagc
gatcatcgcaatcttcagaatctgttgatcctgaccgccatcaaggcggatcgcactcgt
gtcatggactacatcaatcgcttggacaactacgatgcaccagacattgccaacattgcg
atcagcaatcagctgtacgaggaggctttcgccatcttcaagaagttcgatgtgaacacc
tcggccattcaggtgctgatcgatcaggtgaacaatttggagcgcgctaatgagtttgcc
gagcgctgcaacgagccggccgtctggtcacagctggccaaggcacagctgcaacagggc
ctggtcaaggaggccatcgattcgtacatcaaggccgatgatcccagcgcctatatggat
gttgtcgatgttgccagcaaggtggagtcctgggatgatctggtgcgctatctgcaaatg
gcacgcaagaaggcacgcgaatcgtacattgagagcgaattgatctatgcctatgcacgt
actggacgcctcgccgatctcgaggagttcatctcgggccccaatcatgcggacatccag
aagatcggtgatcgctgcttcagcgatggcatgtacgatgcggccaagctgctgtacaac
aatgtcagcaactttgcccgtctggccattacgctggtctatctgaaggagttccagggc
gccgtcgactcggcacgcaaggccaattcgacgcgcacctggaaggaggtctgtttcgcc
tgtgtggacgctgaggagttccgtttggcgcaaatgtgcggccttcatattgtggtgcat
gccgatgagctggaggatttgattaactactatcagaatcgtggctatttcgaggagttg
attgcgctgctggaatcggcgctgggtctcgagcgcgcccacatgggcatgttcagcgaa
ttggcaatactctactccaagttcaagccatcgaagatgcgcgagcatctggagctgttc
tggtcgcgcgtcaatataccgaaggtgttgcgtgccgccgaatcggcgcatctgtggtcc
gagctggtctttctctatgacaaatatgaggaatatgataatgctgtgctcgccatgatg
gcccatccgacggaggcgtggcgcgagggccacttcaaggacatcatcaccaaggtggcc
aacattgagctctactacaaggcaacggaattctatttggagtacaagccgttgctcttg
aacgacatgctcttggtgctggctccacgcatggatcatacccgtgccgtcaactacttc
tcgaagacaggatatctgccgctggtgaaaccctatttgcgttccgtacaatcgctgaac
aacaaggccattaatgaggccctgaatggtctgctcatcgatgaggaggactaccagggc
ttgcgcaattccatcgatggctttgacaacttcgataccattgcgctggcgcagaagctg
gagaagcacgagctcaccgaattccgtcgcattgcggcctatctctacaaaggcaacaat
cgctggaagcagagcgttgagctatgcaaaaaggacaaactgtacaaggatgctatggag
tatgctgccgaatctggtaaacaggagattgccgaggagctgttgggctggttcctggag
cgcaatgcacacgattgctttgcggcatgtctatatcagtgctacgatttgctgcgtccc
gatgttatcctggaactggcatggaaacacaaaatcatggactttgccatgccctacttg
atacaggtgctgcgcgagtacaccaccaaggtggataaactggagctgaatgaggcgcag
cgcgagaaggaggatgatacaacggagcataaaaacataatacaaatggagccgcagctg
atgataacagctggcccagccatgggcataccccagcaatatgcaccaaattatccacct
gttgccgcggcagcagcagcagcggcagcggcaggacgcaacatgggctatcagtatatg
tag

DBGET integrated database retrieval system