KEGG   Drosophila mojavensis: Dmoj_GI15083Help
Entry
Dmoj_GI15083      CDS       T01062                                 

Definition
GI15083 gene product from transcript GI15083-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dmo  Drosophila mojavensis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dmo01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dmo00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dmo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 311 aa AA seqDB search
MFLLLYAAYFVSFLQLGQATYPDCHDSDNRSSNGTVLPVVLWHGMGDTCCFPFSMGSIKK
LIEEHTNGTYVRSLEIGANIVLDYESGFFIHPNKQVDYVCKQLAEDEKLANGYNAIGFSQ
GGQFLRAVAQRCPNPPMRVLISLGGQHQGIYGLPKCPTLSVSSCEYITKLLNYAAYEDWV
QNELVQATYWHDPLHENSYRLKSSFLADINNELYINERYAENLMKLRKFVMVKFLNDTIV
QPKESQWFEFYAPGQDKHILPLNESKVFKNIGLEQMHICKKLHFLSVEGDHLAISKEWFV
KELVPLLLETY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtttttactgctttatgcagcttactttgtaagctttctgcagttgggccaagctacc
tatccagattgtcacgacagtgacaacaggagcagcaatggcactgttctacccgtcgta
ctatggcacggaatgggtgacacttgttgttttccattcagtatgggctctattaagaaa
ctaatcgaggagcataccaacggcacctatgtgcgatccttggaaataggtgcaaacatt
gttttggactatgagagtggcttctttatacatccgaacaagcaggtggactacgtatgc
aaacagctggctgaggatgaaaagctggccaatgggtacaatgccattggcttttctcag
ggcggccaatttttacgagcggtggcccagcgttgtcccaatccgccaatgcgggtgctc
atcagcctgggcggccagcatcagggcatctacggattgccaaagtgtcccacgcttagc
gtcagcagctgcgaatatattaccaaactgctcaactatgcggcctacgaggactgggtc
cagaacgaactggtgcaggccacatactggcatgatccgcttcacgagaacagctatcga
ctgaagagcagcttcctggcggacatcaacaatgaactgtacataaatgaacgctacgca
gagaatctaatgaagctaaggaagtttgtaatggtcaagttcctcaatgacaccattgtg
cagcccaaggagtcgcagtggttcgagttctatgcacctggccaggacaagcacatactg
ccgctcaacgagagcaaagtcttcaaaaatattggcttggagcaaatgcatatatgcaag
aagctgcacttcctcagcgttgagggtgatcatctggccatatccaaggagtggtttgtg
aaggagctcgtgccgctgctactcgaaacatactaa

DBGET integrated database retrieval system