KEGG   Drosophila mojavensis: Dmoj_GI15160Help
Entry
Dmoj_GI15160      CDS       T01062                                 

Definition
GI15160 gene product from transcript GI15160-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dmo  Drosophila mojavensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dmoj_GI15160
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dmoj_GI15160
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dmoj_GI15160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 350 aa AA seqDB search
MWWRRQLASVKLLGRCFSAAASGEQTRLGIIGVPFAKGQGKQGVELAPDLLRESNLRQVL
QSSDERLLITDYGNLHYAVDETLLQQQRQHYYHIRNYADFMACNLALIEQVQVMLQQNAQ
FLTIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHNTSQSGNIHGMPVSFLLRELR
NTWQHAALDKVAPNCLSKDQLVYIGLRDIDPYEAFILNKFGIRYYAMDSIDRMGVPKVIE
MTLDALDTQNKIHVSFDIDALDSNVAPCTGTAVRAGLTLREGISIVEALRDTKRVQGMDI
VEINPKLGTPQDVRTTVDSALEILKSMFGYRRSGARHYSNLDTGILGHEQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggaggcggcagctagcatcagtcaaattgctgggacgctgctttagcgcagcg
gcgagcggggaacaaacccggctgggcatcatcggtgtgccctttgccaagggtcagggc
aaacagggcgtggagctggcgcccgatctgctgcgagagagcaacctgcgccaggtgctg
cagagcagcgacgagcgcctgctcatcaccgattatgggaatttgcactacgccgtcgac
gagacgctgctgcagcagcagcgccagcattattaccacatccgcaactatgctgacttt
atggcctgcaatttggcgttgatcgagcaggtgcaggtgatgctgcagcagaacgcacaa
tttctgacaattggcggcgatcatgccatcggcttcggttccgtggcgggtcatttgcag
cacacgccgaatctgtcgctggtctggatcgatgcgcatgcggatatcaatttgcataac
acctcgcagtcgggcaacatacatggcatgcccgtttcattcctgctgcgagagctgcgc
aacacctggcagcacgcggccctcgacaaggtggcgcccaattgtttgtcgaaggatcaa
ttggtttacattggcttgagggacattgacccctacgaggcgttcatattgaataaattt
ggaatacgctactatgccatggattcgatcgatcgcatgggcgtgcccaaggtcattgag
atgacgctggacgcactcgacacgcaaaacaagatccatgtgagcttcgacatcgatgcg
ctggacagcaatgtggcgccgtgcacgggcaccgccgtccgggccggcctaacgctgcgc
gagggcatcagcattgtggaggcgctgcgcgacaccaagcgtgtccagggcatggacatt
gtggagatcaatccgaagctgggcaccccgcaggatgtgcgcaccacagtcgactcggcc
ctcgagatactgaagagcatgttcggctaccggcgctcgggtgcgcggcattacagcaac
ctggacacgggcatactggggcacgagcagtaa

DBGET integrated database retrieval system