KEGG   Drosophila mojavensis: Dmoj_GI15174Help
Entry
Dmoj_GI15174      CDS       T01062                                 

Definition
GI15174 gene product from transcript GI15174-RA
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmoj_GI15174
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmoj_GI15174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1137 aa AA seqDB search
MVKSKSASSSSSTATSLNAAAGPNANGSAGSCGPRKTSPALQEAKRRARNMLKSQSNGLG
SQLEPIIDIFQNAVNAKSMHRGATALIYDESMSEHCCLWDSTHQERPERFTRTMERCREL
NLVDRCLQLKSRLATKDEILKLHSIEHYERLEQTSGVRNEEAMEELSSHYDAIYIHPSTF
KLSLLASGSTIELIDQLLLGKAQNGMAIIRPPGHHAMKSEFNGYCYFNNVALAAQHALEA
HQLQRILIIDYDVHHGQGTQRFFYNDSRVLYFSIHRYEHGSFWPNLQESDYHAIGSGPGT
GYNFNVPLNTKGMGNGDYLAIFQQLLLPVAMEYQPELIIVSAGYDAALGCPEGEMEVTPA
CYPHLLNPLLHLANCRVAVVLEGGYCVESLSEGAALTLRALLGDPCPPLVERLELPSMEL
RESVLNCIYVHRPYWRCLQLQQTYTPADLESESAATAQLHRVKRIWLGGPPPEPDQRYPT
RGTSAQLPEDVVARNAARLSVLRAETQLSVPAIRVCYAYDAQMLQHFNLHDATHPEQPMR
IRQIHQMHDDYQLLGRMHQLSARAATTDEVCLAHTRAHVNSVRRLLGRSVEELQQMGAGY
NSVYLHPRTFECATLASGSVLQAVDSVLRGQSRSGICNVRPPGHHAEPDQPHGFCIFNNI
AIAAQYAIREFGLERILIVDWDVHHGNGTQHIFESNPKVLYMSIHRYEHGAFFPKGPAGN
YDMVGKNAGRGFNVNIPWNKKGMGDLEYALAFQQLILPIAYEFNPQLVLVSAGFDAAIGD
PLGGCKVTPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQ
FIPAAQRSATVAFQSCVETLQLCVEQQHQYWKSLVFGCKLPQCVLGENNNEDFLAATMSQ
LSISNDNALGAVGGDASQQPDPGQDRPSGSKPKVKVKTLTEFMAEHKEALEQQEMFAIYP
LKSCPHLSQLRSEQAPKSINTSGACGDCGSMVENWMCLSCQSIGCGRYINEHMEQHCRRA
QHPLVLSFSDLSVWCYECNNYIDHPLLYVYQNLAHVDKFKEPMPWTHGCQQRTDGCYPIQ
LDAADSNKQNNNNNNNNNHGASGCSSNANTNNDDDNGSGSGSGSDGVSYYIQLERNN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagtcgaagtcagcgtcgtcgtcgtcgtcgacagcgacgtcgctgaacgcggcg
gctgggccgaacgccaatggaagcgccggcagctgtggaccgcgcaaaacaagtccagcg
cttcaggaggcaaaacgtcgcgcgcggaacatgctgaaatcgcagagcaacggactaggc
tcccagctggagccaattatcgatatctttcagaatgctgtcaatgccaagagcatgcat
cgcggagccacagcgctcatctatgacgagtccatgagcgagcattgttgcctgtgggat
agcacacatcaggagcggcccgaacgctttacgcgtaccatggagcgctgccgcgaactg
aacctcgtggatcgctgcctgcagctgaagtcccgtctggccaccaaggacgaaatcctt
aagctacactcaatagagcactacgagcgactggagcagacgtcgggcgtgcgcaacgaa
gaggctatggaggaactgagctcccactatgacgccatttacatacatccgtccacgttc
aagctgtcgctattggccagtggctcgaccattgagctgatcgatcagctgctgctgggt
aaggcacagaatggcatggccataatccgaccgcctggccatcatgccatgaagtcggag
ttcaatgggtattgctacttcaacaacgtcgcattggccgcacagcacgccctcgaggcg
catcagctgcagcgcatcctgattatcgactacgatgtgcatcatggccagggcactcag
cgtttcttctacaatgattccagagttttgtatttctccatacatcgctatgagcacggc
agcttttggcccaatcttcaggagtcggactaccatgccatcggctccggtcccggcact
ggctacaacttcaatgtcccgctgaataccaagggcatgggcaacggcgattacttggcc
atcttccagcagctgctgctgccggtggccatggaatatcagcccgagctgatcattgtc
tctgctggctatgatgccgccttgggctgcccggagggcgagatggaggtgacgccggcc
tgctatccgcacttgctcaatccgctgctgcacctggccaattgccgtgtggctgtcgtc
ctggagggcggctactgtgtcgagtcgctgtccgagggcgccgccttgacgctgcgtgcg
ctgctcggggatccctgtccgccgctcgtcgaacggctggagctgcccagcatggagctg
cgcgaatcggtgctcaactgcatctatgtgcatcgaccgtactggcgctgcctgcagctg
cagcagacctacacgcccgccgacttggagtcggagagcgcggcaacagctcagctgcat
cgcgtcaagcggatttggctgggcggtccgcctccagagccggatcagcgttatcccaca
cgcggcacctccgctcagctgcccgaggacgtagtcgctcgcaatgccgcccgcctatcc
gtgctgcgcgccgagacgcagctgtcggtgcctgcgatacgggtctgctatgcttacgat
gcccaaatgctgcagcacttcaacttgcacgacgccacgcatccggagcagccgatgcgc
atacggcaaatccatcagatgcacgatgactaccagctgctggggcgcatgcatcagctg
tcggcgcgcgccgccaccacggacgaggtgtgcctggcccatacgcgggcccacgtcaac
tcggtgcgccgcctgctgggccgcagcgtcgaggagctgcagcaaatgggagccggctac
aattcggtgtacctgcatccgcgcaccttcgagtgcgccaccctcgcctccggttcggtg
ctgcaggctgtcgacagtgtcctgcgcgggcaatcgcgcagcggcatctgcaacgttcgc
ccacccggccaccacgccgagccggatcagccgcacggcttttgcatattcaacaacata
gccattgccgcccagtatgccatacgggaattcggcctggagcgcatcctgattgtcgac
tgggatgtgcaccacggcaatggcacacagcacatcttcgagtcgaatcccaaggtgctc
tacatgagcatacatcggtacgagcacggcgccttctttcccaagggcccggcgggcaac
tacgacatggtgggcaagaatgcggggcgtggcttcaatgtgaacataccctggaacaag
aagggcatgggagatctggagtacgcgctggccttccagcagctcatcctgcccattgcg
tacgagttcaatccgcagctggtgctcgtctcggccggcttcgatgcggccatcggtgat
cctctgggtggctgcaaggtgacgcccgaaggctacggcctcttcacccattggctgtcc
gcgttggccggcggccggatcatcgtctgcctggagggtggctacaacgtcaattccata
tcgtatgccatgaccatgtgcaccaagacgctgctgggtgatccggtgccgacgccccag
ttcatcccagccgcccagcgatcggcaacggtggccttccagagctgcgtggaaacgctg
cagctgtgcgtggagcagcagcatcagtattggaagtccttggtctttggctgcaagctg
ccgcagtgtgtgctgggcgagaataataacgaggattttcttgctgctacaatgagtcag
ctaagcatctcaaatgacaatgcactgggcgcagtcggcggcgatgccagccaacagccc
gatcccggccaggatcggcccagtggcagcaagcccaaagtcaaggtaaaaacgctcacc
gagtttatggccgagcacaaggaggcgctcgagcagcaggaaatgtttgccatttatccg
ctcaaaagctgtccacacttgagccagttgcgctcggagcaggcgcccaaatcaataaac
acgagcggcgcatgcggcgactgcggctcaatggtggagaattggatgtgcctgagctgc
cagagcatcggctgcggtcgctacatcaatgagcacatggagcagcattgccgacgcgca
cagcatccgctggtgctgagcttcagcgatttgtccgtgtggtgctacgagtgcaacaac
tacattgaccatccgctgctctatgtctatcagaatctggcgcacgtggacaagtttaag
gagccaatgccctggacgcacggctgccagcagcgcaccgacggctgctacccgatccaa
ctggatgcagctgacagcaacaagcagaacaacaacaacaacaacaacaacaaccatggg
gccagcggctgcagctccaatgcgaacaccaacaatgacgacgacaatggcagtggcagt
ggcagtggcagtgacggtgtcagctactacattcaattggagcgaaataactga

DBGET integrated database retrieval system