KEGG   Drosophila mojavensis: Dmoj_GI15238Help
Entry
Dmoj_GI15238      CDS       T01062                                 

Definition
GI15238 gene product from transcript GI15238-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dmo  Drosophila mojavensis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:dmo04013]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dmo04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 235 aa AA seqDB search
MEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSG
EIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYP
IPPPDSATLEAIFADNADDGNPTVIEPKVMAIFELLDYIVNEPPPKLEHKIFSNEFKDFV
DICLKKQPDERADLKTLLSHPWIRKAEAEDVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggagtacatggacggcggctctcttgatctcatattgaaacgggccggccgcatacct
gaatcaatactcggacgcatcaccttggcggtgctgaagggcctcagctatctgcgggac
aagcatgcaattatccatcgggatgtaaagccaagcaacatactcgtcaatagcagcggc
gagatcaaaatctgtgatttcggcgtttcgggacaactaatcgattcgatggccaactca
tttgtgggcacgcgcagctatatgtcgcctgagcgacttcagggcacacactattcggtt
cagtcggacatttggtcccttggcctttccctcgttgaaatggctatcggcatgtatcca
atacctccgccggacagcgccacgctggaggccatattcgccgataatgctgacgatggc
aacccaacggtaattgagccaaaagtaatggcaatctttgagcttctcgattatattgtt
aacgagccgccgcctaagctggaacacaagatattctccaatgagttcaaggactttgtc
gacatatgcctcaaaaagcaaccagatgagcgggccgatctcaagacgttgctgagccat
ccatggatacgtaaagcggaggcggaggatgttgatatatcgggctgggtgtgcaagaca
atggacttgccgccatcgacgccgaaacgcaatacatcgcccaactaa

DBGET integrated database retrieval system