KEGG   Drosophila mojavensis: Dmoj_GI15238Help
Entry
Dmoj_GI15238      CDS       T01062                                 

Definition
GI15238 gene product from transcript GI15238-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dmo  Drosophila mojavensis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI15238
   04068 FoxO signaling pathway
    Dmoj_GI15238
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmoj_GI15238
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmoj_GI15238
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dmoj_GI15238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 235 aa AA seqDB search
MEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSG
EIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYP
IPPPDSATLEAIFADNADDGNPTVIEPKVMAIFELLDYIVNEPPPKLEHKIFSNEFKDFV
DICLKKQPDERADLKTLLSHPWIRKAEAEDVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggagtacatggacggcggctctcttgatctcatattgaaacgggccggccgcatacct
gaatcaatactcggacgcatcaccttggcggtgctgaagggcctcagctatctgcgggac
aagcatgcaattatccatcgggatgtaaagccaagcaacatactcgtcaatagcagcggc
gagatcaaaatctgtgatttcggcgtttcgggacaactaatcgattcgatggccaactca
tttgtgggcacgcgcagctatatgtcgcctgagcgacttcagggcacacactattcggtt
cagtcggacatttggtcccttggcctttccctcgttgaaatggctatcggcatgtatcca
atacctccgccggacagcgccacgctggaggccatattcgccgataatgctgacgatggc
aacccaacggtaattgagccaaaagtaatggcaatctttgagcttctcgattatattgtt
aacgagccgccgcctaagctggaacacaagatattctccaatgagttcaaggactttgtc
gacatatgcctcaaaaagcaaccagatgagcgggccgatctcaagacgttgctgagccat
ccatggatacgtaaagcggaggcggaggatgttgatatatcgggctgggtgtgcaagaca
atggacttgccgccatcgacgccgaaacgcaatacatcgcccaactaa

DBGET integrated database retrieval system