KEGG   Drosophila mojavensis: Dmoj_GI15342Help
Entry
Dmoj_GI15342      CDS       T01062                                 

Definition
GI15342 gene product from transcript GI15342-RA
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmoj_GI15342
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Dmoj_GI15342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 328 aa AA seqDB search
RLKVADFGLARTLCTKRRSNADLDCKDELDNEAMLTDYVATRWYRAPEILVASRKYTKGI
DMWSLGCILGEMIRQKPLFQGTSTINQIEKIVNALPEVTDRDIESIGASFGSVLLSKKIV
RDRRYSLDEILRNCCDDALSLVKSLLVLDPEGRLTAKEAIAHSYVHRFRTSSANMELRAD
IRPPLDDDTRYGVDEYRTTLYEMIAPELRSSEGHSSTTPVISTVSSDQPSSQTPSGARSE
SKSTTTATTTKTKPTTSTTTTSCRQQRAGLSKSGRETSSSISTSTSSCTSISTPASHLTS
LQQQRQQQQQRQQQRHYSRSAQRQATYP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
aggcttaaggtagccgactttggtctggcgcgcactctgtgcacgaagcggcgaagcaac
gcggatttggactgcaaggatgagctcgataacgaggcgatgctgacagattatgtggcg
acccgttggtatcgggcacccgaaatactggtggccagtcgcaagtatacgaagggcatt
gatatgtggagtctgggctgcatactgggcgagatgatacgccagaagccgctcttccaa
ggcaccagcaccatcaatcagattgagaagatagtgaatgcgctgccggaggtgacggat
cgcgatatcgaatccatcggagctagcttcgggtcggtgctgctcagcaagaagatcgtg
cgggaccggcggtactccctggacgagatactgcgcaattgctgtgacgatgcattgtcg
ctggtaaagtcactgctggtgctcgatccggaagggcggctaaccgccaaggaggccatc
gcccactcctatgtgcatcgctttcgcacctcctcggcgaacatggagctgcgtgccgac
atcaggccgccgttggacgacgatacgcggtacggcgtcgatgagtaccgtaccaccctc
tacgaaatgattgcgcccgagctgcgatctagtgaggggcactcgtccactacaccagtg
atctcaacggttagctccgatcagccgtcgagccagacgccgagcggtgcgcgatctgaa
tcgaaatcaacgacaacagctacaacaactaagacaaagccaacaacatcaacgaccaca
acaagctgtaggcaacagcgtgcgggtctatcaaaaagtggacgagaaacatcctcatcc
atatccacatccacatcttcgtgcacttccatttcaactccagcatcgcatttaacgagc
ttacagcaacagcgacaacaacaacaacaacgacaacaacagcgacattattcgcgttca
gctcagcgtcaagcgacctatccttag

DBGET integrated database retrieval system