KEGG   Drosophila mojavensis: Dmoj_GI15416Help
Entry
Dmoj_GI15416      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dmo  Drosophila mojavensis
Pathway
dmo03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dmoj_GI15416
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmoj_GI15416
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dmoj_GI15416
Transcription machinery [BR:dmo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dmoj_GI15416
Messenger RNA biogenesis [BR:dmo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Dmoj_GI15416
Spliceosome [BR:dmo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmoj_GI15416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 6583886
NCBI-ProteinID: XP_002009548
FlyBase: FBgn0138165
UniProt: B4L2I9
Position
Unknown
AA seq 303 aa AA seqDB search
MAEVLNLDNIIARLLEVRTARPGKNVQLNETEIRGLCLKSREIFLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIKRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVGKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKR
KKQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtacttaatttggacaacatcattgccagactcctggaggtgcgaacagcc
cggcccggtaagaatgtgcaactgaacgagacggagatacgaggcctgtgcctgaagtcg
cgcgaaatcttcctcgcgcaacccattttgcttgagctggaggcgccactgaagatctgc
ggagatatacacggtcagtactacgatctgttgcggctgttcgagtacggcggctatccg
ccggagtcgaactatctattcttgggggactatgtggaccggggcaaacaatcgctggag
accatctgcctgctgctcgcctacaagatcaaatactcggagaacttctttctgctgcga
ggcaaccatgaatgcgcttcaatcaatcgcatctacggcttctatgacgagtgcaagcga
cgctatagcatcaagttgtggaagacattcacggactgcttcaactgtttgcccgttgtc
gccattgtggacgagaagatcttttgctgccatggcggcctcagtccggacctgacatcc
atggagcagatcaagcgtattatgcggcccacggatgtgcccgaccagggtctactgtgc
gatctgctgtggtccgatccggacaaggacaccattggctggggcgaaaacgatcggggc
gttagcttcaccttcggcgccgaggtggttggcaaatttctgcagaagcacgatctcgat
ctcatctgccgggcccatcaggtggtcgaggatggctacgagttctttgccaagcgtcag
ctagtcacgctcttttcggcgcccaactactgcggcgagttcgacaatgcgggcgccatg
atgtccgtcgacgagacgttaatgtgctccttccagatcctcaagcccgtcgagaagcgt
aagaaacaatga

DBGET integrated database retrieval system