KEGG   Drosophila mojavensis: Dmoj_GI15450Help
Entry
Dmoj_GI15450      CDS       T01062                                 

Definition
(RefSeq) GI15450 gene product from transcript GI15450-RB
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI15450
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI15450
Ubiquitin system [BR:dmo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmoj_GI15450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 973 aa AA seqDB search
MLDIKKTRGFHKIPASKLQREANTAASAAAATATDEHQHNGPNGSSGRAAAAAAVGNVNP
VRAANQRYFLVSSYKDPSFLKAECDLAHAQVTLKQAPAGGKTHKRNKALDDHKNNNSSNK
SATAVIANGTGNGTSVSEMRRTTTLNGNKAGGTSSNSTNNTNSGANSSNRATTTTTTTTT
TTASTGAGNSAVHRIDIKYSHSQSQSQSHSHSSKQQLTLGQKTTVAGGTTATSSSAGIGA
GRLVAGKLKPLLLHCNNNHSAMNSHSSYNNNNNNNSSATAATTTTGSSAAIITTTTASGA
ISSSQKMTNICYFKPITPPLQLRNQQLGGDKSNGGQRSIRPKSTIVSFTNSNFAASYEKF
NNYKHTNGEQRPKERERERDRVERDNSAGSSSNARRYGIDSVSIKASIEKFNNLSEQKRQ
PGPLRSNATTSASGSTAAAAAAAAVATAAAAAAAAEGTSNNAGGSSSNLQQRFSGDMEHT
RIAAGYSSSLTRAAYRTGSSNSNTATATAATAAATAASSSAVAPMSKSASRIAHGLLAKA
ANSENAGTAMATTAAAAAAAAMTPTTTANAAANNSHKGSRNVASSVRSVLPPVSPTSSRY
WDRDRDSGRNSTNATTSSIGSSSLSTKHNSLDEGYKSSRDEKFEGLCGLRNIGNTCFMNS
VIQCLSHTTELTRFLRAHHTNTRTATSKDQQILYEFAKLIQEMWTSNVHSVTPMELKRAF
STKHRMYSDYNQQDAQEFLRFFLDSLHSALNTGVKGETLNIDDNLSDNKKADLTWEWYAR
HENSLIRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEACLDLFIREEV
LDGDEMPTCSKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRWSKLSNIVEFPTADRELN
MASYGANANSNVHYSLYAISNHMGSTAGGHYVAICKHPVSRKWHEFNDNSVSDAIPENCL
VSSSAYILFYERA
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgttagacattaagaaaaccagaggattccataagattccagcgtccaaactgcagcgc
gaggcaaacactgcggcatcagcagcagctgcaacggcaactgacgaacaccagcacaac
gggccaaacggcagcagtgggcgggcggcggcggcggcggcggttggcaacgtgaatccg
gtgcgggcggctaatcagcgctattttttggtatccagctacaaagatcccagcttcttg
aaggccgagtgcgatttggcgcatgcccaggtaacgctgaagcaggcgccagctggtggc
aagacgcacaagcgtaacaaggcgctcgacgatcacaagaataataacagcagcaacaaa
tcagcaacagccgtgatagctaacggcactggcaacgggacttcagttagtgagatgcgt
cgaacgacgacgcttaatggcaataaagcgggcggcaccagcagcaacagcaccaacaac
accaacagtggcgccaactcgtcgaacagagcaactacaacaacaacaacgacgacgacg
acgacagcatcaacaggagctggcaactcagccgtccacaggattgatatcaagtatagc
catagccagagccagagccagagccatagccatagcagcaaacagcagctgacattgggc
caaaagacaactgttgcaggaggaacaacggcaacatcctcatccgctggaattggagca
ggacgacttgtggctggtaaactgaagcctctattgctgcactgcaacaacaatcacagt
gcgatgaacagtcatagcagctataataataataacaacaacaacagcagcgccaccgcg
gcaacaacaaccactggatcatcagcagcaataataacaacaacaaccgcatcgggcgcc
atatcatctagccaaaagatgacaaacatttgctacttcaagcccataacgccgccactg
cagctgcgcaaccagcagctgggcggagataaatccaatggtggtcagcgctcgatccgg
cccaagtcgacgatagtctcgttcaccaattcgaactttgcggccagctacgagaagttt
aacaactacaagcacacaaatggcgaacagcggcccaaggagcgggagcgtgaacgggat
cgtgtggagcgggacaatagcgccggcagcagcagcaatgcgcgacgctatggcatcgat
tcggtcagcattaaggcgtccattgagaagtttaacaatctgagcgaacagaagcgacaa
ccgggaccgttgcgcagtaatgcaacaacatctgcgtctggctcgacagcagcagcagcg
gcagcggcagcagttgcaacagcagcggcagcagcagcagctgcggaaggcacctcaaac
aatgctggcggcagcagcagcaatctgcagcagcgcttcagcggcgatatggaacataca
cgcattgcggctggctatagcagctccttgacgcgtgccgcttatcgcaccggcagcagc
aacagcaatacagcaacggcaacagcagcgacagcagcggcaacggcagcatcatcatca
gctgtggcgcccatgagcaagtcggccagccggattgcccacggcctgttggcgaaggcg
gccaactcggaaaatgctggcacagcgatggcaacaacagcagcagcagcagcagccgcg
gcaatgacgccaacaacaacggccaatgcagcggccaacaacagccacaagggatcgcgc
aatgtcgcaagcagcgttcgctcagtgctgccgccagtgtcgccaacgtcgagccgttac
tgggaccgggatcgggacagcggacggaacagtaccaacgccacaacctcttccattggc
tcatcgtcgctgagcacgaagcataatagcctggacgagggctacaaaagcagccgagac
gaaaagttcgaaggtctatgcggtctgagaaatattggaaacacttgcttcatgaactcg
gtcatccaatgcctgagtcacacgactgagctgacgcgcttcttgcgcgcccatcacacc
aacacgcgcacggcaacctccaaggatcagcaaatactatacgaatttgccaaactcata
caggaaatgtggacgtcaaatgtgcatagtgtaacgccgatggaactgaagcgtgccttt
tcgacaaagcatcgcatgtatagcgattacaatcagcaggatgcgcaggagtttctgcgc
ttctttcttgactcgctgcactcggcactgaacaccggtgtcaaaggtgaaacgcttaac
attgacgataatctcagtgacaataagaaggccgatctgacttgggagtggtatgctagg
catgagaattccctgatacgagatttgtttgttggtcaattgaagagcacactgaagtgt
acaacgtgtggcaatacgagcgttacctttgacccattctgggatctgagtgtgccacta
ccatcgtcatcgcgctgcaaattagaggcctgcttagatctgttcattagagaagaggtg
ctagatggcgacgagatgcccacgtgctccaaatgcaagacacgccgaaaatgtaccaaa
agctttaccatacagcgtttccccaaatacctggtgatacatctaaaacgtttctcagaa
acacgctggagcaagctctcgaatattgttgagttccctacggcggatcgggagctgaat
atggcctcatatggggcaaacgcaaattcgaatgtgcattattcgctctatgcgatctcc
aatcatatgggctcaacggctggcggtcactacgtggccatctgtaagcatccagtctcc
cgcaagtggcatgagttcaatgataatagcgttagcgatgctatccccgagaactgtctc
gtttcatccagtgcctatatcctattctacgaacgagcgtaa

DBGET integrated database retrieval system