KEGG   Drosophila mojavensis: Dmoj_GI15450Help
Entry
Dmoj_GI15450      CDS       T01062                                 

Definition
GI15450 gene product from transcript GI15450-RA
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI15450
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI15450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1158 aa AA seqDB search
MRVISPRRSSTSAAGSGSLYGTTSTSGAGSSASTSGTSSGSVSGGGGGTSNGYSRYSGSY
YDNRGSSLSKYLPSSAGSGTSAAGSSSTSTSAYNHHSSSSASNYYPSSYSTYSSTPRVST
QRNSIASPLYLSGGTGSVLNSGYRTSSSYLSNYDTISYGRCGLPRRAKGTLSNGDGGAAG
SAASSTSTAAGTKNDDCSGRAAAAAAVGNVNPVRAANQRYFLVSSYKDPSFLKAECDLAH
AQVTLKQAPAGGKTHKRNKALDDHKNNNSSNKSATAVIANGTGNGTSVSEMRRTTTLNGN
KAGGTSSNSTNNTNSGANSSNRATTTTTTTTTTTASTGAGNSAVHRIDIKYSHSQSQSQS
HSHSSKQQLTLGQKTTVAGGTTATSSSAGIGAGRLVAGKLKPLLLHCNNNHSAMNSHSSY
NNNNNNNSSATNNSNSNNNMQRQQQQQQQQHDDISYIDSDDIPTSTAAAGAAAATAMTNI
CYFKPITPPLQLRNQQLGGDKSNGGQRSIRPKSTIVSFTNSNFAASYEKFNNYKHTNGEQ
RPKERDSSNARRYGIDSVSIKASIEKFNNLSEQKRQPGPLRSNATTSASGSTAAAAAAAA
VATAAAAAAAAEGTSNNAGGSSSNLQQRFSGDMEHTRIAAGYSSSLTRAAYRTGSSNSNT
ATATAATAAATAASSSAVAPMSKSASRIAHGLLAKAANSENAGTAMATTAAAAAAAAMTP
TTTANAAANNSHKHNNDTAGAAAAAAAAANSTSAYTYSAAAAGSRNVASSVRSVLPPVSP
TSSRYWDRDRDSGRNSTNATTSSIGSSSLSTKHNSLDEGYKSSRDEKFEGLCGLRNIGNT
CFMNSVIQCLSHTTELTRFLRAHHTNTRTATSKDQQILYEFAKLIQEMWTSNVHSVTPME
LKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNTGVKGETLNIDDNLSDNKKADLTW
EWYARHENSLIRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEACLDLF
IREEVLDGDEMPTCSKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRWSKLSNIVEFPTA
DRELNMASYGANANSNVHYSLYAISNHMGSTAGGHYVAICKHPVSRKWHEFNDNSVSDAI
PENCLVSSSAYILFYERA
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgatttcgccgcgtagatcgtcaacgtcagcagcgggcagtggcagtctctac
ggcacaacgtcgaccagtggcgctggcagctcggccagcactagcggcacaagcagcggc
agcgtcagcggcggcggcggcggcacaagtaacggctactcgcgctactccggcagctac
tacgataatcgcggcagcagtctatccaaatacctgccctcgtcagctggttcgggtaca
tcagcagccggctcctcatccacatccacatccgcctacaatcatcacagcagcagcagc
gcgagcaactactatcccagctcctattcaacctattcgagtacgccgcgcgtcagcaca
cagcggaatagcatcgcatctccattgtatctgagcggaggaactggctctgttctcaat
tctggatatcggactagttcatcgtatttgagcaactatgatacaatttcgtatggccga
tgcggattgccgcgtcgagcaaagggcacactatcgaatggcgatggcggagcagctgga
tcagcagcaagctcgacaagcacagcagcaggaacaaagaatgacgattgcagtgggcgg
gcggcggcggcggcggcggttggcaacgtgaatccggtgcgggcggctaatcagcgctat
tttttggtatccagctacaaagatcccagcttcttgaaggccgagtgcgatttggcgcat
gcccaggtaacgctgaagcaggcgccagctggtggcaagacgcacaagcgtaacaaggcg
ctcgacgatcacaagaataataacagcagcaacaaatcagcaacagccgtgatagctaac
ggcactggcaacgggacttcagttagtgagatgcgtcgaacgacgacgcttaatggcaat
aaagcgggcggcaccagcagcaacagcaccaacaacaccaacagtggcgccaactcgtcg
aacagagcaactacaacaacaacaacgacgacgacgacgacagcatcaacaggagctggc
aactcagccgtccacaggattgatatcaagtatagccatagccagagccagagccagagc
catagccatagcagcaaacagcagctgacattgggccaaaagacaactgttgcaggagga
acaacggcaacatcctcatccgctggaattggagcaggacgacttgtggctggtaaactg
aagcctctattgctgcactgcaacaacaatcacagtgcgatgaacagtcatagcagctat
aataataataacaacaacaacagcagcgccaccaacaatagcaacagcaacaacaatatg
caacgccagcagcagcagcagcagcaacaacatgacgacattagctatattgatagcgac
gatataccgaccagcacagcagcagcaggagcagcagcggcgacagcgatgacaaacatt
tgctacttcaagcccataacgccgccactgcagctgcgcaaccagcagctgggcggagat
aaatccaatggtggtcagcgctcgatccggcccaagtcgacgatagtctcgttcaccaat
tcgaactttgcggccagctacgagaagtttaacaactacaagcacacaaatggcgaacag
cggcccaaggagcgggacagcagcaatgcgcgacgctatggcatcgattcggtcagcatt
aaggcgtccattgagaagtttaacaatctgagcgaacagaagcgacaaccgggaccgttg
cgcagtaatgcaacaacatctgcgtctggctcgacagcagcagcagcggcagcggcagca
gttgcaacagcagcggcagcagcagcagctgcggaaggcacctcaaacaatgctggcggc
agcagcagcaatctgcagcagcgcttcagcggcgatatggaacatacacgcattgcggct
ggctatagcagctccttgacgcgtgccgcttatcgcaccggcagcagcaacagcaataca
gcaacggcaacagcagcgacagcagcggcaacggcagcatcatcatcagctgtggcgccc
atgagcaagtcggccagccggattgcccacggcctgttggcgaaggcggccaactcggaa
aatgctggcacagcgatggcaacaacagcagcagcagcagcagccgcggcaatgacgcca
acaacaacggccaatgcagcggccaacaacagccacaagcacaacaacgacacagcggga
gcagcagcagcggcagcagctgctgctaactcgaccagcgcctacacttactctgccgcc
gccgcaggatcgcgcaatgtcgcaagcagcgttcgctcagtgctgccgccagtgtcgcca
acgtcgagccgttactgggaccgggatcgggacagcggacggaacagtaccaacgccaca
acctcttccattggctcatcgtcgctgagcacgaagcataatagcctggacgagggctac
aaaagcagccgagacgaaaagttcgaaggtctatgcggtctgagaaatattggaaacact
tgcttcatgaactcggtcatccaatgcctgagtcacacgactgagctgacgcgcttcttg
cgcgcccatcacaccaacacgcgcacggcaacctccaaggatcagcaaatactatacgaa
tttgccaaactcatacaggaaatgtggacgtcaaatgtgcatagtgtaacgccgatggaa
ctgaagcgtgccttttcgacaaagcatcgcatgtatagcgattacaatcagcaggatgcg
caggagtttctgcgcttctttcttgactcgctgcactcggcactgaacaccggtgtcaaa
ggtgaaacgcttaacattgacgataatctcagtgacaataagaaggccgatctgacttgg
gagtggtatgctaggcatgagaattccctgatacgagatttgtttgttggtcaattgaag
agcacactgaagtgtacaacgtgtggcaatacgagcgttacctttgacccattctgggat
ctgagtgtgccactaccatcgtcatcgcgctgcaaattagaggcctgcttagatctgttc
attagagaagaggtgctagatggcgacgagatgcccacgtgctccaaatgcaagacacgc
cgaaaatgtaccaaaagctttaccatacagcgtttccccaaatacctggtgatacatcta
aaacgtttctcagaaacacgctggagcaagctctcgaatattgttgagttccctacggcg
gatcgggagctgaatatggcctcatatggggcaaacgcaaattcgaatgtgcattattcg
ctctatgcgatctccaatcatatgggctcaacggctggcggtcactacgtggccatctgt
aagcatccagtctcccgcaagtggcatgagttcaatgataatagcgttagcgatgctatc
cccgagaactgtctcgtttcatccagtgcctatatcctattctacgaacgagcgtaa

DBGET integrated database retrieval system