KEGG   Drosophila mojavensis: Dmoj_GI15566Help
Entry
Dmoj_GI15566      CDS       T01062                                 

Definition
GI15566 gene product from transcript GI15566-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dmo  Drosophila mojavensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmoj_GI15566
Enzymes [BR:dmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dmoj_GI15566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 269 aa AA seqDB search
MSSQQRTVIIFKSESESTDVYAETLLAHNFQPLFVPTLSFGFKNLEQLRAKLQTPDKYAG
IIFTSPRCVEAVAEALQLAELPSGWKLLHNYAVGEVTHNLAMSTLQQLFTHGKQTGNARN
LGDFIVDTFDGSRNLPLLLPCGNLATDTLLSKLAENGFCVDACEVYETKCNPQLAECMDR
ALKAENIEFLAFFSPSGVNCAYEYFKARNIAPDQWKLVAIGPSTRRALESLGLKVLCTAE
RPTVEHLVKVLLNPQESRERLLRERLDVA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagcagcggacggtgattatattcaaatcggaatcggagagcacggatgtc
tacgcggagactctgctggcgcacaactttcagccgttgttcgtgccgacgctgagcttc
ggcttcaaaaatcttgaacagctgcgggccaagctgcagacgccggacaaatatgcgggc
atcatcttcaccagtccgaggtgtgttgaggccgttgccgaggcactgcaactggcggag
ctgcccagcggttggaaactattgcataactatgccgtcggcgaggttacgcacaatctg
gccatgagcacgctgcagcagctattcacccacggcaagcagacgggcaacgcccggaat
ctgggcgacttcattgtggacacgttcgatggatcacgaaatctgccgttgctgctgccg
tgcggcaatctggccacggacacgctgctctcgaagctggcggagaatggtttctgtgtg
gatgcgtgcgaggtgtacgagacgaagtgcaatccacagctggccgagtgtatggatcgt
gccctgaaggcggagaatattgagttcctggcattcttctcaccctccggtgtgaattgt
gcgtatgaatacttcaaggcccgcaacattgcgccggatcagtggaagctggtggccatt
gggccgagcactcgacgcgccctggagtcgctggggctgaaggtactgtgcaccgcagag
cggccaacggtggagcatctggtgaaggtattgctcaacccgcaggagagtcgtgagcgc
ctgcttcgggagcgcctggacgtagcataa

DBGET integrated database retrieval system