KEGG   Drosophila mojavensis: Dmoj_GI16100Help
Entry
Dmoj_GI16100      CDS       T01062                                 

Definition
GI16100 gene product from transcript GI16100-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dmo  Drosophila mojavensis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI16100
   03008 Ribosome biogenesis in eukaryotes
    Dmoj_GI16100
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dmoj_GI16100
Ribosome biogenesis [BR:dmo03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dmoj_GI16100
Transfer RNA biogenesis [BR:dmo03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dmoj_GI16100
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dmoj_GI16100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 163 aa AA seqDB search
MDSHPPERGAKPKSNRNKQQSQHIVRKLPPRVTNDKRNNIYITSKSDFKAQQKRCEDLLN
AGTKEIYLHCMGYSITRGLTLALRLIDNSDGALSYAINTSTIKLVDELHPLCDEDDITYR
QRNNSALHIKIFNNSLFDIVVPKLPAQTSCTEVNIKKPQKKQK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggacagtcatccaccagaacgcggtgcaaagccaaaaagcaatcgcaataaacaacaa
agccaacacattgtacgaaaacttccgcctcgtgtaacaaacgacaagcgaaataatatt
tacattacaagcaagtcagactttaaggcccaacaaaaacgatgcgaagatctgttgaat
gcgggcactaaggaaatctatttgcattgcatgggttattcgataacacgtgggcttact
ttggcattgcgacttatcgataactcggacggtgctctaagctacgcaataaacacatcc
actatcaagctggtggatgaactgcatccactttgtgatgaggacgacataacctacaga
caacgcaacaattccgcattgcacatcaaaatcttcaataacagtctgttcgatattgtg
gtacccaaactgccagcacagacgagctgcacagaggttaacattaagaagccacaaaag
aaacagaaatag

DBGET integrated database retrieval system