KEGG   Drosophila mojavensis: Dmoj_GI16100Help
Entry
Dmoj_GI16100      CDS       T01062                                 

Definition
GI16100 gene product from transcript GI16100-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dmo  Drosophila mojavensis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dmo03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dmo03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 163 aa AA seqDB search
MDSHPPERGAKPKSNRNKQQSQHIVRKLPPRVTNDKRNNIYITSKSDFKAQQKRCEDLLN
AGTKEIYLHCMGYSITRGLTLALRLIDNSDGALSYAINTSTIKLVDELHPLCDEDDITYR
QRNNSALHIKIFNNSLFDIVVPKLPAQTSCTEVNIKKPQKKQK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggacagtcatccaccagaacgcggtgcaaagccaaaaagcaatcgcaataaacaacaa
agccaacacattgtacgaaaacttccgcctcgtgtaacaaacgacaagcgaaataatatt
tacattacaagcaagtcagactttaaggcccaacaaaaacgatgcgaagatctgttgaat
gcgggcactaaggaaatctatttgcattgcatgggttattcgataacacgtgggcttact
ttggcattgcgacttatcgataactcggacggtgctctaagctacgcaataaacacatcc
actatcaagctggtggatgaactgcatccactttgtgatgaggacgacataacctacaga
caacgcaacaattccgcattgcacatcaaaatcttcaataacagtctgttcgatattgtg
gtacccaaactgccagcacagacgagctgcacagaggttaacattaagaagccacaaaag
aaacagaaatag

DBGET integrated database retrieval system