KEGG   Drosophila mojavensis: Dmoj_GI16149Help
Entry
Dmoj_GI16149      CDS       T01062                                 

Definition
GI16149 gene product from transcript GI16149-RA
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI16149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 530 aa AA seqDB search
MKTKYEFDDDVSSICESTAALTEGCRLSVRMHKTDDWPLAEIVSIKEQDGKRQFYVHYVD
FNKRLDEWVNEDDLDTRKVQFPRRDGPQTGTSTGVTTPKRHHSLAGSVSRPTSPQPQHAS
GLGGTIAGSGGSMANNSGTELVNGNNVLAAALQKRINRRRKVHGAHHSQSLQQQQQAQSQ
QQLPQTPQTPQTPVHVTGDGGLLPATPLGGATAAGNDDASQDGKMATPRQSGSMVTHQDD
VVTRMKNVEMIELGRHRIKPWYFSPYPQELCQQSCIYICEFCLKYCKSRKCLERHLSKCN
LRHPPGNEIYRKNTISFFEIDGRKNKFYAQNLCLLAKLFLDHKTLYYDTDPFLFYIMTEF
DSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEK
PLSDLGLLSYRSYWAQTILEILISQNSGTDGEKPTITINDICECTSIKKEDVISTLQNLN
LINYYKGQYIVCIGRETIEQHQRAMQKRKIRIDSKCLHWTPKDWSKRSKW
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaatacgaattcgacgatgatgtttcatcaatttgtgaatcgacggccgcc
ttgaccgagggctgtcgtctgtccgtgcgcatgcacaagaccgatgattggcccctggcc
gagattgtgagcatcaaagagcaggacgggaagcgtcagttctatgtgcactatgtggac
tttaacaagcgtctggacgagtgggtcaacgaggatgacttggacacgcgcaaggtgcag
tttccacggcgcgacgggccgcaaactggcaccagcacgggcgtcaccacgcccaagcgc
catcattcgctggctggcagtgtgtcgcgcccgacatcaccgcagccgcagcacgccagc
ggcctgggcggcaccatcgctggctctggcggctccatggctaacaacagcggcactgag
ctggtcaatggcaacaatgtgctagctgctgcgttgcagaagcgcatcaatcgtcgtcgc
aaggtgcacggggcacatcattcgcagtcgctgcagcagcagcaacaggcgcagtcgcag
cagcagctgccacagacacctcagactccacagacgcctgttcacgtgacaggcgatggc
ggattgctgcccgcaactcctctgggcggggctacagctgctgggaacgacgacgcctcg
caggacggcaagatggcaacgccccgccagtcgggcagcatggtcactcaccaggatgac
gtggtcacgcgcatgaagaatgtagagatgatcgagcttgggcgccaccgcatcaagccc
tggtacttctcgccgtatccgcaggagctgtgccagcagagctgcatttacatctgcgag
ttctgcctgaagtactgcaagagccgcaagtgcctggagcgccacttgtccaagtgcaac
ctccgccacccaccgggcaacgagatctatcgcaagaatacaatctcgtttttcgagatc
gacggacgcaagaacaagttctacgcccagaacctttgcctgttggccaagctattctta
gaccacaagacgctctactatgacacagatccgttcttgttctacatcatgaccgagttt
gactcgcgcggctttcatattgttggctacttctccaaggagaaggagagcaccgaggac
tacaacgtggcatgtatcttgaccatgccgccatatcaacgcaagggttacggcaagctt
ctcatcgagttcagctatgagctgtccaagttcgagggcaagaccggctcgccggagaag
ccgctctccgacttgggcttgctctcctatcgctcgtactgggcccagaccatactggag
atactgattagccagaactctggcacagatggcgagaagcccaccataaccatcaacgac
atctgtgagtgcacctctattaagaaggaggacgtgatctccactttgcagaatctgaat
ctgatcaactactacaagggtcagtacattgtctgcattgggcgcgagactattgaacag
catcagcgcgccatgcagaagcgcaagattcgtatcgactccaagtgcctccactggacc
cccaaggattggtccaagcgctccaagtggtaa

DBGET integrated database retrieval system