KEGG   Drosophila mojavensis: Dmoj_GI16291Help
Entry
Dmoj_GI16291      CDS       T01062                                 

Definition
GI16291 gene product from transcript GI16291-RA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmoj_GI16291
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dmoj_GI16291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 335 aa AA seqDB search
MSRPRPRLPPIGIPREPEPAFVPPRNLDSRATIQIGDQTFDIDADSLEKICDLGRGAYGI
VEKMRHRQTGTVLAVKRIPMTVNFREQQRLIMDLDISMRSSDCPYTVHFYGAMYREGDVW
ICMEVMNTSLDKFYPKVFKNQLTMEETVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNIL
INRSGQVKICDFGISGYLVDSVAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIS
MIEMATGQYPYNKWRTPFEQLRQVVEDDPPRLTAGTFSAEFEDFIATCLKKEYTARPNYE
QLLRHSFIVEHLQRNTDISEFVARILDLPDEQASQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccacgtccgcgtctcccacccattggcattccgcgtgagccggaaccggca
tttgtgccaccacgtaatctggactcccgggcgaccatacaaatcggcgatcaaacattc
gacatcgatgcggatagtttggagaagatttgtgatttaggacgcggcgcttatggcatc
gtggagaagatgcgacacaggcagacgggcactgtgctggccgtcaagcgcatcccaatg
acagtgaacttccgtgaacagcaacgtctgatcatggatctggatatatcgatgcgatcc
agcgattgcccctatacggtccacttttatggggccatgtaccgggagggcgatgtctgg
atctgcatggaggtgatgaacaccagtttggacaaattctacccgaaggtcttcaaaaat
cagctaaccatggaggagacggtgctcggcaaaatcgcgatgagcgtggttagcgccttg
cattatctgcatgcccagctgaaggtcatccatcgcgatgtaaagccatcaaatatattg
atcaatcgcagcggccaggtgaaaatatgtgattttggcatctcaggctatctggtcgat
tcggtggcaaagactatagacgctggctgtaagccatatatggcaccggaacgtattgat
ccgcaaggtaatccagcccaatacgatatacgctccgatgtctggtcgctgggcatcagc
atgatcgaaatggccaccgggcaatatccctataacaaatggcgaacgccctttgaacag
ttgcgtcaggttgttgaggatgatccgccacgactgacggccggcacattctccgcagag
ttcgaggactttatagcgacgtgcttgaaaaaggaatatacggcgagacccaattacgag
cagctgctgcggcacagctttatcgtggagcatttacaacgcaacacggatatatccgag
tttgtggcaagaatattagatctgcccgatgagcaggcgtcgcagtag

DBGET integrated database retrieval system