KEGG   Drosophila mojavensis: Dmoj_GI16291Help
Entry
Dmoj_GI16291      CDS       T01062                                 

Definition
GI16291 gene product from transcript GI16291-RA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 335 aa AA seqDB search
MSRPRPRLPPIGIPREPEPAFVPPRNLDSRATIQIGDQTFDIDADSLEKICDLGRGAYGI
VEKMRHRQTGTVLAVKRIPMTVNFREQQRLIMDLDISMRSSDCPYTVHFYGAMYREGDVW
ICMEVMNTSLDKFYPKVFKNQLTMEETVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNIL
INRSGQVKICDFGISGYLVDSVAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIS
MIEMATGQYPYNKWRTPFEQLRQVVEDDPPRLTAGTFSAEFEDFIATCLKKEYTARPNYE
QLLRHSFIVEHLQRNTDISEFVARILDLPDEQASQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccacgtccgcgtctcccacccattggcattccgcgtgagccggaaccggca
tttgtgccaccacgtaatctggactcccgggcgaccatacaaatcggcgatcaaacattc
gacatcgatgcggatagtttggagaagatttgtgatttaggacgcggcgcttatggcatc
gtggagaagatgcgacacaggcagacgggcactgtgctggccgtcaagcgcatcccaatg
acagtgaacttccgtgaacagcaacgtctgatcatggatctggatatatcgatgcgatcc
agcgattgcccctatacggtccacttttatggggccatgtaccgggagggcgatgtctgg
atctgcatggaggtgatgaacaccagtttggacaaattctacccgaaggtcttcaaaaat
cagctaaccatggaggagacggtgctcggcaaaatcgcgatgagcgtggttagcgccttg
cattatctgcatgcccagctgaaggtcatccatcgcgatgtaaagccatcaaatatattg
atcaatcgcagcggccaggtgaaaatatgtgattttggcatctcaggctatctggtcgat
tcggtggcaaagactatagacgctggctgtaagccatatatggcaccggaacgtattgat
ccgcaaggtaatccagcccaatacgatatacgctccgatgtctggtcgctgggcatcagc
atgatcgaaatggccaccgggcaatatccctataacaaatggcgaacgccctttgaacag
ttgcgtcaggttgttgaggatgatccgccacgactgacggccggcacattctccgcagag
ttcgaggactttatagcgacgtgcttgaaaaaggaatatacggcgagacccaattacgag
cagctgctgcggcacagctttatcgtggagcatttacaacgcaacacggatatatccgag
tttgtggcaagaatattagatctgcccgatgagcaggcgtcgcagtag

DBGET integrated database retrieval system