KEGG   Drosophila mojavensis: Dmoj_GI16329Help
Entry
Dmoj_GI16329      CDS       T01062                                 

Definition
(RefSeq) GI16329 gene product from transcript GI16329-RB
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Autophagy
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmoj_GI16329
   04150 mTOR signaling pathway
    Dmoj_GI16329
 Cellular Processes
  Transport and catabolism
   04140 Autophagy
    Dmoj_GI16329
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dmoj_GI16329
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmoj_GI16329
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dmoj_GI16329
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dmoj_GI16329
  Mitophagy factors
   Other mitophagy factors
    Dmoj_GI16329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 808 aa AA seqDB search
MQQQQPEPFHEHQFPQQQQHQQPPPVLEEQPPAQLPPQPPPQPLQLLPVPASALRPVYAV
DSNGYLVPTPYALVPAQFVAQAGATTTTTTTTTTTTTAMYGVNCGYYNYANASIVNSFVN
YDHDASQMCAMGMVYVEYKCASPGEVAVTAAAAAAAAAALAQTQAAAYAIAQAHAQAHAR
AQAVARARDYCNPIALKIITITITTKTTTTTHSHIDKHRCCCIPRCHSREPAAAEAAAAS
NSGAQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRLKVAVKILNRQKIKSLDVVSKIKR
EIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQI
ISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPE
VISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPSLFRKIKSGIFPIPEYLNKQVVN
LVCQMLQVDPLKRATIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDTYAVAEVCTKFGVK
ESEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAATQISEINNFFVAGSPPPPTAHSPHE
PRSSAQESGAQGGGATVTIGGGTAASSGTATPSGLGSSATPTIRPHPERIAPMRERQLAM
SVQNTGGAAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRAMKALNYEWKIINPY
HVRVRRQNVKTGKYSKMSLQLYQVDPKSYLLDFKSLTNDEVEQGDDVIMESLTPPPLSVG
GTMPVQPTGHHTMEFFEMCAALIIQLAR
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcagcaacctgaacccttccatgagcaccaattccctcaacaacaacaacac
caacaaccaccaccagtactagaggaacagcctccagcacagcttccacctcaaccgcca
ccgcaacccctccagctgcttcctgtgcctgccagcgctttgcggcccgtttacgcagtg
gatagcaatggctatttggttcccacaccctatgccctagttcccgcccagtttgtggcc
caagcgggggcaacaacaacaacgacgactacaaccacaacaacaaccactgcgatgtat
ggcgtcaactgcggctactataattacgcgaacgcaagcattgtgaatagctttgttaac
tatgatcacgacgcgagtcagatgtgcgcaatgggcatggtctatgtcgaatacaaatgt
gcctcacccggcgaggtggcggtaacagctgccgccgcagcagcagctgctgcagcctta
gcacagacgcaggcggcagcttatgcgatcgcgcaggcgcatgcacaggcgcatgcgcga
gcacaggcagtggcgcgggcgagggactattgcaatccaattgcattgaaaatcataacg
ataacgattacgacgaagacgacgacgacgacacactcacacatcgataaacaccgctgc
tgctgcatcccaagatgccacagtcgagagcccgctgccgctgaggcggccgctgcttcc
aactccggcgcccagccgcttgtcaagattggccactatctgctgggagcgacgctcggc
accggcacctttggcaaggtgaagattggcgaacatcaaatcacacgactcaaggtcgcc
gtcaagattctcaatcgtcagaagatcaagagcctcgatgtggtgtccaaaatcaaacgt
gaaatccaaaacttgaaactcttccggcatccgcacatcatcaagctataccaggtcatc
tccacaccatcggatatattcatgatcatggaatatgtgagcggcggagagttgttcgat
tatattgtaaagcatggcaagctgcaggagcatcaggcgcgccgcttcttccagcagatc
atatcgggcgtggactactgccacaggcatatgatagtgcatcgagatctgaagccggag
aatctgctgctcgatcacaatatgcacgtgaagatcgccgactttggcctgtccaacatg
atgctcgatggcgagttcttgcgcacgtcttgcggctcacccaactatgcggcgcccgag
gtgatttcgggtaaactgtatgccggtccggaggtggacatctggtcatgcggtgtcatc
ctgtacgcgctgctctgcggcactctgccgttcgatgacgagcatgtgccgtcgctgttt
cgcaaaatcaaatcgggcatctttcccataccggagtacctgaacaagcaggtggtgaat
ctagtgtgtcagatgctgcaggtggatccgctgaagcgtgccaccatcgaggagatcaag
aagcacgagtggttccagaaggatctgcccgcctatctcttcccctcgtccattgagcag
gactcgaacgtgatcgacacgtatgccgtggccgaggtctgcaccaagttcggcgtcaag
gagtccgaggtgcacaactccctgctcagtggcgatccgcacgaccagctggccatcgcc
taccatctgatcattgacaacaagcgctttgcggacgatgcggccactcagataagtgag
attaacaatttttttgtggccggctcgccgccaccgcccacagcccattcgccgcacgag
ccgcgctcgagtgcccaggagtcgggcgcacagggaggaggcgccactgtcaccatcggc
ggcggcacggcggccagctctggcacagccacgcccagcggcctgggtagcagtgctacg
cccaccatacggccacatcccgagcgcattgcaccgatgcgtgaacgccagctggccatg
tccgtgcagaatacgggcggagccgccttcccggagaagacagcacgcggcggcactccg
atcaagcgcgccaaatggcatctgggcatacgatcgcagagcaagccgaacgacatcatg
ctcgaggtgtatcgcgccatgaaggccctcaactacgagtggaagatcatcaatccgtat
catgtgcgtgtccggcgccagaacgtgaagactggcaaatattcaaagatgtcgctgcag
ctctaccaggtggaccccaagagctatctgctcgacttcaaatcactgaccaacgacgaa
gtcgaacagggcgacgatgtgatcatggagagcctgacgccgccgccattgagtgtgggt
ggcacgatgccagtgcagcccactggacaccatacgatggagttcttcgagatgtgcgcc
gcactcatcatacagctggcgcgctaa

DBGET integrated database retrieval system