KEGG   Drosophila mojavensis: Dmoj_GI16344Help
Entry
Dmoj_GI16344      CDS       T01062                                 

Definition
GI16344 gene product from transcript GI16344-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 829 aa AA seqDB search
MYRLEDTNSGAVMDKNKQKLSAGYGSSGGAVDTSQGSGSGGGGGGGGGGRQRHAPLYGRF
VVEEELPATHRDVMHHHSSPSSSSEVRAMQARIPPHFRDPASAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGK
GSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRH
FMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCD
LKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIQYDLAIDMWSL
GCILVEMHTGEPLFSGCNEFDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVTDGSYVLK
KTLNGRKYKPPGSRKLHDILGVETGGPAGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTR
VTPYYALQHNFFKRTTDESTNTSGGLLLHHANNNSCSSSSNSSSNNNSSNNNSNANAMNF
SALSLQPQSATTANSSSSLNSLNSSSNNNLNINNNNSLNSLNHSSSSGVGVSSGRRNIYM
GNSYPHAMDCDPPLGQQQMPPPPLPPVSAATMAAAALRLGQTPFGRMRNSGVGIAPHQNF
SNIKHNGNVVQLPPQPTSLLLPPLPPPAAHQQMQLPTQPQPHHSYAPASLPLDLMHHYGN
MSAAASHLMMTDSSVISASAAGGPPAGSGPASYGVLLYHPQPLAPLPLPMQMPASASTSS
SLAALPASAATSSGGGSGSVSSTAGASSDASSSSPMVGVCVQQNPVVIH
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattggaggatactaacagcggcgctgttatggataagaacaaacagaaatta
tccgctggatatggttccagcggcggcgccgtggacacatcgcagggtagtgggagcggc
ggcgggggcggcggcggtggcggcggcagacagcgccatgcgccgctctacggacgcttt
gtggtcgaagaggaactgcctgccacgcatcgtgatgttatgcatcatcactctagtcct
tcgtcttcgtcggaggtgcgcgccatgcaggcacgcatacccccgcattttcgagatccg
gccagtgcaccattgcgaaagctgagcgtcgatctgataaagacctacaagcacatcaat
gaggtatactacgcaaagaagaaacgccgagcccagcagacacaaggcgatgatgactcg
tcaaataaaaaggagcgcaaattatacaatgatggttacgatgatgataatcacgactat
atcatcaagaatggcgagaagtttctggatcgctacgagattgattcactcatcggcaaa
ggcagttttggtcaagtggtcaaggcctacgatcatgaggagcaatgccatgtggcaatc
aagataattaagaataagaaaccgttcctaaatcaggcacaaattgaagtcaagctgctg
gagatgatgaatcgtgcggatgctgaaaacaaatactatatcgtcaagctcaagcgtcat
tttatgtggcgcaatcatctgtgcctcgtcttcgagctgctatcgtataatctatacgat
ctattgaggaacacgaatttccgtggcgtttcgctgaacctcacgcgcaaatttgcgcag
caactgtgcacggctcttctgttcctgagcacacccgaactgaacataatacactgtgat
ctgaagcccgagaacatattgctatgcaatcccaagcgatcggccatcaaaattgttgac
tttggcagctcctgtcagctgggacagcgcatctatcaatacatccagtcgcgcttctat
cgctcaccggaggtactgctgggcattcaatacgatttggccatcgatatgtggtcgctc
ggctgcattctggtggagatgcataccggagagccgctgttctccggatgcaacgagttc
gatcagatgaacaagattgtcgaggtgctgggaatgccgcccaagtatctgttggatcag
gcgcataagacgcgcaagttcttcgacaagattgtcaccgatggctcctacgtgctaaag
aagacactcaatgggcgcaagtataagccgcccggttcccgcaagctacatgacatactc
ggcgtggagacaggcgggccggctggcaggcgtctcgatgagccgggacattctgtgtcc
gactatctcaagttcaaggatctgatattgcgcatgctcgactttgatccgaagacacga
gtcactccctactacgccttgcagcacaacttcttcaagcgcaccaccgacgagtcgacc
aacacgagcggcggtctgttattgcaccacgcgaacaacaacagttgcagcagcagcagc
aacagcagcagcaacaacaacagtagcaacaacaacagcaatgccaatgcgatgaacttt
tcggcgctcagtctgcagccgcagtcagcgacaacagcgaacagcagcagcagcctcaac
agccttaacagcagcagcaacaacaaccttaacataaacaataataacagtctgaatagc
ttaaatcatagcagcagcagcggcgtcggcgtcagcagtggtcgccgcaatatttatatg
ggcaacagctatccgcacgccatggactgtgatccgccgctggggcaacaacagatgccg
ccaccgccactgccgcccgtctcggccgcaactatggcagcggcagcgctgcgtctcggc
cagacgccatttgggcgcatgcgcaacagcggcgtcggcattgcgccacaccagaatttc
agcaacattaagcataatggtaatgtagtgcaattgccaccacagccgacgtcgctgctt
ctaccgccgctgccaccacccgccgcacatcaacaaatgcaactgccgacacagccgcag
ccgcatcacagctatgcgccagcgtcgctgccgctcgacctgatgcatcattatggcaac
atgtccgccgctgcctctcatctgatgatgaccgattcgagcgttatcagcgcctctgct
gctggcggacctccagctggctccgggccggcctcatatggggtactactgtatcatccg
cagccgttagctccgctgccgctgcccatgcaaatgccagcttctgcgtcgacatcgtca
tcgttggctgcgctgccagcgtcggcagcaacgtccagcggtggtggcagcggcagcgtc
agctctacagccggtgccagcagcgatgcctcttcgtcgtcgcccatggtgggcgtatgt
gttcaacagaatcctgtagttatacattag

DBGET integrated database retrieval system